KEGG   Burkholderia pyrrocinia: ABD05_21190Help
Entry
ABD05_21190       CDS       T03962                                 

Definition
(GenBank) AraC family transcriptional regulator
Organism
bpyr  Burkholderia pyrrocinia
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AraC_binding_2 HTH_18 HTH_AraC
Motif
Other DBs
NCBI-ProteinID: AKM02717
UniProt: A0A0G3WVK8
LinkDB All DBs
Position
2:complement(1095883..1096863)
Genome map
AA seq 326 aa AA seqDB search
MTNSTVFSRTRGSTADVPARDRMAYWDAFNAATLVGLRCSSLSPAGLEVEKTDIALPGLG
VADISGQDHVIERSPALVRQLPKESLFACQILSGRAYFIQRDRCLLAEAGDVVVYDTRVP
YLFGFLTPMRQLLIDIPITTFDDRLDAELAALPLRIAPKPGAGAMLGATLRASVERFMRD
PVERDAARFAEHTRTLIAELIDAEVNGAGASRASLSYLLTAKQYIATHLGEPELGPQAVA
DAVGLSLRHLGRLFAAEGESITQHIWSERLSHAYRELTDARLRKTSVGEIAFRWGFSSQA
HFSRAIRERYGASPMALRDAARAAEC
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaattcgaccgttttttcacgcacgcgaggctcgacggccgacgtgccggcgcgc
gaccggatggcgtactgggatgcgttcaacgcggcgacgctggtcggcctgcgttgttcg
tcgctgtcgccggccgggctcgaagtcgagaagaccgacatcgcgctgccgggcctcggc
gtcgccgacatcagcggccaggatcacgtgatcgagcgcagccccgctttggtgcggcag
ttgccgaaggaatcgctgttcgcgtgccagatcctgagcgggcgcgcgtatttcatccag
cgcgaccggtgcctgctcgcggaagccggcgatgtcgtcgtctacgacacgcgcgtgcct
tatctgttcggattcctgacgccgatgcggcaactgctgatcgatatcccgatcacgacg
ttcgacgaccggctcgatgcggaactggccgcgctgccgttgcggatcgcgccgaagccg
ggcgcgggtgcgatgctcggcgcgacgctgcgcgcgagcgtcgagcggttcatgagggat
ccggtcgagcgcgatgccgcgcgattcgccgagcacacgcgcacgctgatcgcggaactc
atcgacgcggaagtgaacggcgcgggcgcatcgcgcgcgtcactgtcgtacctgctgacc
gcgaagcagtacatcgcgacgcatctcggcgagccggagctcgggccgcaggcggtggcc
gacgcggtgggcctgtcgctgcgtcatctcggccggctttttgcggccgaaggcgagtcg
atcacgcagcacatctggtcggaacggttgtcgcatgcgtatcgcgagctgacggatgcg
cggctgcgcaagacgagcgtcggcgagatcgcgtttcgctgggggttctcgagccaggca
cacttcagccgcgcgattcgcgagcgctacggcgcatcgccgatggcgctgcgcgacgcg
gcgcgcgcggctgagtgctga

DBGET integrated database retrieval system