KEGG   Burkholderia pyrrocinia: ABD05_21200Help
Entry
ABD05_21200       CDS       T03962                                 

Definition
(GenBank) MFS transporter
Organism
bpyr  Burkholderia pyrrocinia
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr LacY_symp MFS_1_like
Motif
Other DBs
NCBI-ProteinID: AKM02719
UniProt: A0A0G3WWM5
LinkDB All DBs
Position
2:1097600..1098904
Genome map
AA seq 434 aa AA seqDB search
MTSHPSRKLAWTYENRLLLILFMTFGFVFFDRLALSFLFPFMSAELHLTNAQLGMVSSAL
ALTWALSGAATGAWSDARGTRKPLLIAAVLGFSVCSALSGLVGGFASLIAFRALMGIAEG
PVLPLSQSLMVESSTPSRRGLNMGLLQGSAAGLLGAMIGPPVVIGIATAYGWRHAFFVSC
IPGFLIAFCIWRWVREMPPGGARHAQADTVGTPAAGSAAISRWALLKERNILLCVLISCF
FLTWFIVIISFAPVFLVDSRHLSPADMGVVMTCLGAAWVFWGFAVPAISDRIGRKPTMIV
FALIAAACPVAMIHANSLGALCALVLATYTGLGCFTLFMATIPAETVPPRSIASALGLIM
GAGELIGGFVAPTVAGFAADKYGLQFAMWTSATGAILACVLSFGLVETAPAVLRKRALAG
AAANRLDTQNLGGR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccacccttcccgcaagcttgcatggacgtacgagaacaggctgctgctgatc
ctgttcatgacgttcggcttcgtgttcttcgaccgcctcgcgctgtcgttcctgttcccg
ttcatgtctgccgaactgcacctgacgaatgcgcagctcggcatggtgtcgtccgcgctc
gcgctcacgtgggcgctgtcgggcgccgcgaccggcgcgtggtccgacgcgcgcggcacg
cgcaagccgctgctgatcgccgcggtgctcggcttttccgtgtgctcggcgctgtcgggg
ctggtcggcggcttcgcgagcctgatcgcgttccgcgcgctgatgggcatcgccgaaggc
cccgtgctgccgctgtcgcagtcgctgatggtcgagagttcgacgccgagccgccgcggg
ctgaacatgggcctgctgcagggctcggccgccggcctgctcggcgcgatgatcggcccg
ccggtcgtgatcgggatcgcgaccgcgtacggctggcgccacgcgttcttcgtatcgtgc
attcccggcttcctgatcgcgttctgcatctggcgctgggtccgcgaaatgccgcccggc
ggcgcacggcatgcgcaggccgacaccgtcggcacgccggcggcgggcagcgcggcgatc
agccgctgggcgctgctgaaggaacgcaacatcctgctgtgcgtgctgatcagctgcttc
ttcctcacgtggttcatcgtgatcatctcgttcgcgccggtgttcctcgtcgacagtcgc
cacctgtcgcccgccgacatgggcgtcgtgatgacctgcctcggcgctgcgtgggtgttc
tggggcttcgcggtgcccgcgatctccgaccggatcggccgcaagccgacgatgatcgta
ttcgcactgatcgccgccgcgtgccccgttgcgatgattcacgcgaattcgctgggggcg
ctctgcgcgctcgtgctcgcgacctacacgggcctcggctgcttcacgctgttcatggcg
acgatcccggccgaaacggtgccgccccgctcgatcgccagcgcgctcgggctgatcatg
ggcgccggcgagctgatcggcggcttcgtcgcgccgaccgtcgccggcttcgcggcggac
aagtacggcctgcagttcgcgatgtggacgtcggcaaccggcgcgatcctcgcgtgcgtg
ctgtcgttcggtctcgtcgaaaccgcgcccgccgtgctgcgcaagcgcgcgctcgccggc
gccgccgcgaaccgtctcgatacgcagaacctcggaggacgctga

DBGET integrated database retrieval system