KEGG   Burkholderia pyrrocinia: ABD05_22780Help
Entry
ABD05_22780       CDS       T03962                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bpyr  Burkholderia pyrrocinia
Pathway
bpyr00250  Alanine, aspartate and glutamate metabolism
bpyr00410  beta-Alanine metabolism
bpyr00640  Propanoate metabolism
bpyr00650  Butanoate metabolism
bpyr01100  Metabolic pathways
bpyr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpyr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ABD05_22780
   00650 Butanoate metabolism
    ABD05_22780
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ABD05_22780
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ABD05_22780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bpyr01007]
    ABD05_22780
Enzymes [BR:bpyr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ABD05_22780
Amino acid related enzymes [BR:bpyr01007]
 Aminotransferase (transaminase)
  Class III
   ABD05_22780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AKM02997
UniProt: A0A0G3WWD2
LinkDB All DBs
Position
2:complement(1456033..1457322)
Genome map
AA seq 429 aa AA seqDB search
MTVKNADLQARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRH
PKIVKAIADQLNNFTHTAYQIVPYASYVELAEKINARAPGDFPKKTAFFTTGAEAVENAI
KIARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNAVHGVT
TADSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFYQAPAEFVRALRKICNEHGILLIAD
EVQTGFARTGKLFAMQHYDVLADLITMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYA
GNPLAVASAHAVLEIIDEEKLCERATQLGDVLKAKLSALQADVPQIADVRGPGAMIAVEF
LKPGSGEPDAEFTKRVQTRALERGLLLLVCGVYSNVVRFLFPLTIPEAVFDEALVILEEV
LKETVGVPA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgaagaatgccgacctgcaggcccgcaagaacgccgctaccccgcgcggcgtc
ggtgtgatgtgcgatttctacgcagcccgcgccgagaacgcggaactgtgggatgtcgaa
ggccgccgcttcatcgatttcgccgccggcatcgcggtgctgaacacgggccaccgccac
ccgaagatcgtcaaggcgatcgcggatcaactgaacaacttcacgcacaccgcttaccag
atcgtcccgtacgcgtcgtacgtcgagctggccgagaagatcaacgcacgcgcgccgggc
gatttcccgaagaagaccgcgttcttcacgaccggcgccgaagccgtcgagaacgcgatc
aagatcgcgcgcgccgcgaccggccgtccgggcgtcatcgcattctcgggcggcttccac
ggccgcacgatgatgggcatggcgctgaccggcaaggtcgccccgtacaagctgaacttc
ggcccgttcccgggcgacgtgttccacgcgccgtacccgaacgccgtacacggcgtgacg
accgccgactcgatcaaggcaatcgagatgctgttcaaggccgacatcgatccgaagcgc
gtcgccgcgatcatcttcgaaccggtccagggcgaaggcggtttctaccaggcgccggcc
gaattcgtgcgcgcgctgcgcaagatctgtaacgaacacggcatcctgctgatcgccgac
gaagtgcaaacgggcttcgcgcgtaccggcaagctgttcgcgatgcagcactacgacgtg
ctggccgacctgatcacgatggcgaagagcctcgcgggcggcatgccgctgtcgggcgtc
gtcggccgtgcggacgtgatggacgcggcagcgcccggcggcctcggcggcacgtacgcg
ggcaacccgctggccgtcgcatcggcgcacgcggtgctcgagatcatcgacgaagagaag
ctgtgcgagcgcgccacgcaactcggcgacgtgctgaaggcgaagctgagcgcgctgcag
gccgacgtgccgcagatcgccgacgtgcgcggcccgggcgcgatgatcgcggtcgagttc
ctgaagccgggttcgggcgagccggatgcggaattcacgaagcgcgtgcaaacgcgcgcg
ctcgagcgcggcctgctgctgctcgtgtgcggcgtgtactcgaacgtcgtgcgcttcctg
ttcccgctgacgattcccgaggccgtgttcgacgaagcgctcgtgatcctcgaggaagtg
ctgaaggaaacggtcggcgtgccggcctga

DBGET integrated database retrieval system