KEGG   Burkholderia pyrrocinia: ABD05_29915Help
Entry
ABD05_29915       CDS       T03962                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bpyr  Burkholderia pyrrocinia
Pathway
bpyr00440  Phosphonate and phosphinate metabolism
bpyr01100  Metabolic pathways
bpyr01120  Microbial metabolism in diverse environments
bpyr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpyr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    ABD05_29915
Enzymes [BR:bpyr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     ABD05_29915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: AKM04246
UniProt: A0A0G3X2I4
LinkDB All DBs
Position
2:3111875..3113563
Genome map
AA seq 562 aa AA seqDB search
MNAREPNFTESRSARLRRMLVSSDLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQTDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGKAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQAVAREIHENETLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAVVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKKQGVNDITVVGGYR
ADAIDTSGIKLVVNERHAQTGELASLACAAERLTGDTVISYGDLLFRSYILRDLAESEAE
FSVVVDSSLTEPTNQSVRDFALCSAADDRGLFGQKTYLQRVSSDVAAGTPHGRWIGLLNV
RGAGVDRLKAMLATLQARDDFDTLDIPTLLNELIAAGEKIEVQYVHGHWRGVNDLEDFRR
AGDFAHGQTPLSEPGAGNGGAQ
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacgcgaacccaatttcaccgaatcgcgcagcgcgcgcctgcgccgcatgctc
gtcagcagcgacctcgaattcctgatggaagcgcacaacgggctgtccgcgcggatcgtc
cgcgaggccggcttcaaggggatctgggcgtcgggcctcgcgatttccgcgcagttcggc
gtgcgcgacaacaacgaggccagctggacgcaggtcgtcgacgtgctcgaattcatggcc
gacgcgagcgacctgccgatcctgctcgatggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgaacagcgcggcatcgccggcgtctgcatcgaggac
aagcagttcccgaaaacgaacagcttcatcgacggcgagcgccagccgctcgccgagatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagaccgatcccgacttctcg
atcgtcgcgcgcgtcgaggcgctgatcgcgggctgggggatggacgaggcgctgcgccgc
gcgaacgcgtatgcggaagccggcgccgacgcgatcctgatccacagcaagctgtcgcgc
ccggacgagatcctgcagttcgcgcgcgaatggagtggcaaggcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccacctgatccgcgcatcggcttcggcgatgcaggccgtcgcgcgcgag
atccacgagaacgaaacgctgatcaacgtcgaagaccgcgtcgcatcggtcaacgagatc
ttccgcctgcaggacgccgacgaatactcggcggccgagcgcatctacctgtcgtcgtcg
tcgcgcgcgtcgaacgccgcggtcgtgctcgccgcgagccgcggcaagggcctcgaagcc
gtcaccgaagacaagcccaaggtcatgctgccggtcgccggcaagccgctgctgcgctgg
ctcgtcgacggcttcaagaagcaaggcgtgaacgacatcaccgtggtcggcggctatcgc
gccgacgcgatcgacacgtcgggcatcaagctcgtcgtcaacgagcgccatgcgcaaacc
ggcgaactcgcgtcgctcgcctgcgcggcggaacgcctgaccggcgacaccgtgatctcg
tacggcgacctgctgttccgcagctacatcctgcgcgacctcgcggagagcgaggccgaa
ttcagcgtggtggtcgattcgtcgctgacggagccgaccaaccagagcgtgcgcgacttc
gcgctctgctcggcggcggacgatcgcggcctgttcggccagaagacgtatctgcaacgt
gtatcgagcgacgtcgccgcaggcacgccgcacggccgctggatcggcctgctgaacgtg
cgcggcgcgggcgtcgatcgcctgaaggcgatgctcgcgacgctgcaggcgcgcgacgat
ttcgacacgctcgacatccccacgctcctcaacgaactgatcgccgccggcgagaagatc
gaggtgcagtacgtgcacggccactggcgcggcgtcaacgatctcgaggacttccgccgc
gcgggcgacttcgcgcacggccagacgccgctgtccgaaccgggcgccggcaacgggggc
gcgcaatga

DBGET integrated database retrieval system