KEGG   Burkholderia pyrrocinia: ABD05_29920Help
Entry
ABD05_29920       CDS       T03962                                 

Definition
(GenBank) phosphonopyruvate decarboxylase
  KO
K09459  phosphonopyruvate decarboxylase [EC:4.1.1.82]
Organism
bpyr  Burkholderia pyrrocinia
Pathway
bpyr00440  Phosphonate and phosphinate metabolism
bpyr01100  Metabolic pathways
bpyr01120  Microbial metabolism in diverse environments
bpyr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpyr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    ABD05_29920
Enzymes [BR:bpyr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.82  phosphonopyruvate decarboxylase
     ABD05_29920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: AKM04247
UniProt: A0A0G3WZV8
LinkDB All DBs
Position
2:3113560..3114756
Genome map
AA seq 398 aa AA seqDB search
MIEAAQFVEAARERGFDWYAGVPCSYLTPFINYVLQDPTLHYVSAANEGDAVALIAGATL
GGKRGIAMMQNSGLGNAVSPLTSLTWTFRLPQLLIVTWRGQPGVADEPQHALMGPITPAM
LDTMEIPWETFPTDPEQVGPALDRAIAHMDATGRPYALVMQKGSVAPYELKANPAAQPRA
HVAAQASSRAASADAWPTRHDALQRVIAHTPVDSTVVLASTGFCGRELYAIDDRPNQLYM
VGSMGCVTPLALGLALARPDLRVVAVDGDGAALMRMGVFATLGTYGPANLTHVLLDNGAH
ESTGGQATVSQHVSFAGVAAACGYASAVEGDTLDVLDATLAAPGDGVRPSGAQFVRLAIR
TGVPDGLPRPTVTPVEVKTRLMRHLGAAQTEAHAEGAL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaagcggcccagttcgtcgaggccgcgcgcgaacgcggcttcgactggtacgcg
ggcgtgccctgctcgtacctgacgccgttcatcaactacgtgctgcaggacccgacgctg
cactacgtgtcggccgcgaacgaaggcgacgcggtcgcgctgatcgcgggcgcgacgctc
ggcggcaagcgcgggatcgcgatgatgcagaactcggggctcggcaacgcggtgagcccg
ctgacgtcgctgacctggacgttccggctgccgcaactgctgatcgtcacgtggcgcggc
cagcccggtgtcgccgacgagccgcagcacgcgctgatgggcccgatcacgcccgcgatg
ctcgacacgatggagatcccgtgggagacgttcccgaccgaccccgaacaggtcggcccg
gcgctcgaccgcgcgatcgcgcacatggacgcgacgggccgcccgtacgcgctcgtgatg
cagaaaggcagcgtcgcgccgtatgaactgaaggcgaacccggcggcgcagccgcgcgcg
catgtcgccgcgcaagcgtcgtcgcgcgccgcgtcggccgacgcgtggccgacccgtcac
gacgcgctgcagcgcgtgatcgcgcacacaccggtcgattcgaccgtggtgctcgcgtcg
accggtttctgcggccgcgaactctacgcaatcgacgatcgcccgaaccagttgtacatg
gtcggctcgatgggttgcgtgacgccgctcgcactcggcctcgcgctcgcgcgccccgac
ctgcgcgtggtggccgtcgacggcgacggcgccgcgctgatgcgcatgggcgtgttcgcg
acgctcggcacctacggcccggccaatctcacgcacgtgctgctcgacaacggcgcgcac
gaatcgacgggcggccaggcaaccgtgtcgcagcatgtgtcgttcgcgggcgtcgcggcc
gcatgcggctacgcgtcggcggtcgaaggcgacacgctcgacgtgctcgatgcgacgctg
gctgcgccgggcgatggggtccggccatccggtgcacagttcgtgcgcctcgcgatccgc
acgggcgtgcccgacggcctgccgcgcccgaccgtcacgccggtcgaggtcaagacccgt
ctgatgcggcacctcggcgccgcgcagaccgaagcccacgctgaaggagccctttga

DBGET integrated database retrieval system