KEGG   Burkholderia pyrrocinia: ABD05_30080Help
Entry
ABD05_30080       CDS       T03962                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bpyr  Burkholderia pyrrocinia
Brite
KEGG Orthology (KO) [BR:bpyr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ABD05_30080
Enzymes [BR:bpyr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ABD05_30080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_binding_3 NAD_binding_7 NAD_binding_8 Thi4 DAO K_oxygenase FAD_oxidored Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: AKM04279
UniProt: A0A0G3X0X3
LinkDB All DBs
Position
2:3153298..3154896
Genome map
AA seq 532 aa AA seqDB search
MLDANLKNQLKAYLEKITRPIELVASLDDSAKSQELHALLNEIASLTDRVTVTERRDDAE
RKPSFSIGEPGKPSGIRFAGIPMGHEFTSLVLALLQTGGHPIKLDDDVIEQIRSLDGDYA
FETYFSLSCQNCPEVVQALNVMSLINPRIRHVAIDGALFQNEVESRQIMAVPTMFLNGAS
FGQGRSSVKEILAKLDTGASARAAKSLENKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYDVDIMDVQRADALIPGDVHQ
IRLANGAVLKAKTIILATGARWREINVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVKEVTLIEYGAQLRADEVLQRKLRSLPNVTIVTQAQTIELTGDGSKL
NGLVYKDLRSGETQRIDLEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLGAFDHLIRQDVTPAAAAQPQAEEAVAA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctcaagaaccaactgaaagcgtacctcgaaaagatcacgcgcccg
atcgaactcgtcgcctcgctcgacgacagcgcgaaatcgcaggaactgcatgcgctgctg
aacgagattgcgtcgctgacggatcgcgtgaccgtgaccgaacgccgcgacgacgccgag
cgcaagccgtcgttctcgatcggcgagcccggcaagccgtccggcatccgcttcgccggc
attccgatgggccatgaattcacgtcgctcgtgctcgcgctgctgcagacgggcggccac
ccgatcaagctcgacgacgacgtgatcgaacagatccgctcgctcgacggcgactacgcg
ttcgagacgtacttttcgctgtcgtgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatgtcgctgatcaacccgcgcatccgccacgtcgcgatcgacggcgcactgttccag
aatgaagtcgagtcgcgccagatcatggccgtgccgacgatgttcctgaacggcgcatcg
ttcggccagggccgcagcagcgtgaaggaaatcctcgcgaagctcgatacgggcgcgagc
gcccgtgccgcgaagtcgctcgagaacaagccggtgttcgacacgctgatcgtcggcggc
ggcccggcaggcgcggccgcggcaatctactcggcgcgcaagggcatcgcgacgggcgtc
gtcgccgagcgtttcggcggccaggtgctcgacacgatggcgatcgagaacttcgtgtcg
gtgcaggaaaccgaagggcccaagttcgcgaccgcgctcgagcagcacgtgaagcaatac
gacgtcgacatcatggacgtacagcgcgccgacgcgctgatcccgggcgacgtgcaccag
atccgcctcgcgaacggcgcggtgctgaaggcgaagacgatcatcctcgcgaccggcgcg
cgctggcgcgaaatcaacgtgccgggcgagcgcgaataccgcaatcgcggtgtcgcttac
tgcccgcactgcgacggcccgttgttcaagggcaagcgcgtcgcggtggtcggcggcggc
aactcgggcgtcgaggccgcgatcgacctcgccggcatcgtgaaggaagtcacgctgatc
gaatacggcgcgcaactgcgcgcggacgaagtgctgcagcgcaagctgcgcagcctgccg
aacgtgacgatcgtcacgcaggcgcagacaatcgagctgaccggcgacggcagcaagctg
aatgggctcgtctacaaggacctgcgctcgggcgaaacgcagcgcatcgatctcgaaggc
gtgttcgtgcagatcggcctcgtgccgaacaccgaatggctgaaaggcacggtcgaactg
tcgaagcacggcgagatcgtcgtcgatgcacgcggcgcgacgtcggtgcccggcgtgttc
gcggccggcgacgtgacgacggtgccgttcaagcagatcgtgatcgcggtgggtgaaggc
gcgaaggcatcgctcggcgcgttcgaccacctgatccggcaggacgtgacgccggcagca
gcggctcagccgcaggccgaagaagcggtcgccgcttaa

DBGET integrated database retrieval system