KEGG   Burkholderia pseudomallei 1026b: BP1026B_I0294Help
Entry
BP1026B_I0294     CDS       T02049                                 

Definition
(GenBank) NUDIX family pyrophosphatase
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
bpz  Burkholderia pseudomallei 1026b
Brite
KEGG Orthology (KO) [BR:bpz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bpz03400]
    BP1026B_I0294
Enzymes [BR:bpz01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     BP1026B_I0294
DNA repair and recombination proteins [BR:bpz03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    BP1026B_I0294
 Prokaryotic Type
    BP1026B_I0294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX NUDIX_4
Motif
Other DBs
NCBI-ProteinID: AFI64960
UniProt: A0A0H3HEI8
LinkDB All DBs
Position
1:300553..301002
Genome map
AA seq 149 aa AA seqDB search
MSGEVTNAAAPAATGRKVTEVAVGVLVRPDGRYLLAQRLIGKPYEGYWEFPGGKLEAGES
VEAALARELHEELGIAVTECHRWHTLEHDYPHAYVRLYFCKVTGWTGEPHSREGQAFVWQ
HLPVDVAPLLPAALPVLELLAREQGDARQ
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcgaagtcacgaacgcggcggcgcccgccgccacgggccgcaaggtgaccgag
gtggcggtcggtgtgctggtgcggcctgacggccggtacctgctcgcgcagcggttgatc
ggcaagccttacgaagggtactgggaatttccggggggcaagctcgaggcgggcgagagc
gtcgaggcggcgctcgctcgcgaactgcacgaggaactgggtatcgccgtgaccgaatgc
catcgctggcacacgctcgagcacgactatccgcacgcatacgtccgtctgtatttctgc
aaggtgacggggtggacaggcgagccgcacagccgggaggggcaggcgttcgtctggcag
catttgccggtcgacgtcgcaccgctgctgcccgccgcactgcccgtgctcgagttgctc
gcgcgcgagcagggcgacgcgcggcaataa

DBGET integrated database retrieval system