KEGG   Burkholderia pseudomallei 1026b: BP1026B_I3445Help
Entry
BP1026B_I3445     CDS       T02049                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bpz  Burkholderia pseudomallei 1026b
Brite
KEGG Orthology (KO) [BR:bpz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bpz03012]
    BP1026B_I3445
   03029 Mitochondrial biogenesis [BR:bpz03029]
    BP1026B_I3445
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpz04147]
    BP1026B_I3445
Translation factors [BR:bpz03012]
 Eukaryotic Type
  Elongation factors
   BP1026B_I3445
 Prokaryotic Type
   BP1026B_I3445
Mitochondrial biogenesis [BR:bpz03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BP1026B_I3445
Exosome [BR:bpz04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BP1026B_I3445
  Exosomal proteins of breast cancer cells
   BP1026B_I3445
  Exosomal proteins of colorectal cancer cells
   BP1026B_I3445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AFI68024
UniProt: A0A0H3HP01
LinkDB All DBs
Position
1:complement(3810415..3811605)
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSAKFGGEAKKYDEIDAAPEEKARG
ITINTAHIEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIIKGSAKLALE
GDKGELGEVAIMNLADALDTYIPTPERAVDGAFLMPVEDVFSISGRGTVVTGRVERGVIK
VGEEIEIVGIKATAKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLAKPGS
ITPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagagaagtttgagcggaccaagccgcacgtgaacgttggtacgattggtcac
gttgaccacggcaagacgacgctgacggcagcgatcgcgacggtgctgtcggcgaagttc
ggcggcgaagcgaagaagtacgacgaaatcgacgcggcgccggaagaaaaggcgcgcggc
atcacgatcaacaccgcgcacatcgagtacgaaacggcgaaccgccactacgcacacgtg
gactgcccgggccacgccgactacgtgaagaacatgatcacgggcgcggcgcagatggac
ggcgcgatcctggtgtgctcggccgctgacggcccgatgccgcaaacgcgtgagcacatc
ctgctggcgcgtcaggtcggtgtgccgtacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgcggagctgctcgagctggtcgaaatggaagtgcgcgaactgctgtcgaag
tacgacttcccgggcgacgacacgccgatcatcaagggttcggcgaagctggcgctggaa
ggcgacaagggcgagctgggcgaagtggcgatcatgaacctggccgacgcgctggacacg
tacatcccgacgccggagcgtgcggtcgacggcgcgttcctgatgccggtggaagacgtg
ttctcgatctcgggccgtggtacggtggtgacgggtcgtgtcgagcgcggtgtgatcaag
gttggcgaggaaatcgaaatcgtcggtatcaaggcgacggcgaagacgacctgcacgggc
gtggaaatgttccgcaagctgctggaccagggtcaggcgggcgacaacgtcggtatcctg
ctgcgcggcacgaagcgtgaagacgtggagcgcggccaggttctggcgaagccgggttcg
atcacgccgcacacgcacttcacggctgaagtgtacgtgctgagcaaggacgaaggcggc
cgccacacgccgttcttcaacaactaccgtccgcagttctacttccgtacgacggacgtg
acgggctcgatcgagctgccgaaggacaaggaaatggtgatgccgggcgacaacgtgtcg
atcacggtgaagctgatcgcgccgatcgcgatggaagaaggtctgcgcttcgcgatccgc
gaaggcggtcgcaccgtcggcgccggcgtcgtcgccaagatcatcgagtaa

DBGET integrated database retrieval system