KEGG   Burkholderia pseudomallei 1026b: BP1026B_I3657Help
Entry
BP1026B_I3657     CDS       T02049                                 

Gene name
acoD
Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz00010  Glycolysis / Gluconeogenesis
bpz00620  Pyruvate metabolism
bpz01100  Metabolic pathways
bpz01110  Biosynthesis of secondary metabolites
bpz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BP1026B_I3657 (acoD)
   00620 Pyruvate metabolism
    BP1026B_I3657 (acoD)
Enzymes [BR:bpz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BP1026B_I3657 (acoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFI68218
UniProt: A0A0H3HV77
LinkDB All DBs
Position
1:4015903..4017522
Genome map
AA seq 539 aa AA seqDB search
MHRGAACWHGFGVTNGVAHVARRITDTDMRGATMNHADMQHLNIEFPYRKQYGNFIGGEW
VAPVGGEYFDNVSPVTGRPFTAIPRSREADIELALDAAHAAKAGWAAKGAAERANVLLRI
ADRMEANLTRLAVAETIDNGKPLRETTAADVPLAIDHFRYFAGCIRAQEGSIADIGGDMV
AYHFHEPLGVVGQIIPWNFPLLMAAWKLAPALAAGNCVVLKPAEQTPASILVFAELIQDL
LPPGVLNIVNGFGLEAGKPLASSKRIAKIAFTGETSTGRLIMQYASENLIPVTLELGGKS
PNIFFADVMDRDDSYFDKALEGFAMFALNQGEVCTCPSRALVEESIYDRFIERALKRVEA
IKQGHPLDSQTMIGAQASAEQLEKILSYIDIGRGEGAQCLTGGERNVLGGELAEGYYVKP
TVFRGHNKMRIFQEEIFGPVLAVTTFKTEEEALEIANDTLYGLGAGVWTRDGNRAYRFGR
GIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMMLDHYQQTKNLLVSYSEKPLGFF
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgcggcgcggcgtgctggcacggttttggcgtaacgaacggcgtcgcgcacgtc
gcgcggcgcatcaccgataccgacatgcgaggagcaacgatgaatcacgcggacatgcaa
catctgaacatcgaattcccgtaccgcaagcagtacgggaatttcatcggcggcgaatgg
gtcgccccggtcggcggcgagtatttcgacaacgtctcgcccgtcaccggccggccgttc
accgcgatccctcgctcgcgcgaagccgacatcgagctcgcgctcgacgccgctcacgcg
gccaaggcgggctgggccgcgaagggcgcggccgagcgcgcgaacgtgctgctgaggatc
gccgaccggatggaggcgaacctcacgcgcctcgccgtcgccgagacgatcgacaacggc
aagccgctgcgcgaaaccaccgcggccgacgtgccgctcgcgatcgaccacttccgctac
ttcgcgggctgcatccgcgcgcaggaaggctcgatcgccgatatcggcggcgacatggtg
gcctaccacttccacgagccgctcggcgtcgtcggccagatcatcccgtggaacttcccg
ctgctgatggccgcgtggaagctcgcgccggcgctcgcggccggcaactgcgtcgtgctc
aagccggccgagcagacgcccgcgtcgatcctcgtgttcgccgagctgatccaggatctg
ctgccgcccggcgtgctcaacatcgtcaacggcttcggcctcgaggccggcaagccgctc
gcgtcgagcaagcggatcgcgaagatcgcgttcacgggcgagacgtcgacgggccgcctc
atcatgcagtacgcgagcgagaacctgattcccgtcacgctcgagctgggcggcaagagc
ccgaatattttcttcgccgacgtgatggatcgcgacgacagctacttcgacaaggcgctc
gaaggcttcgcgatgttcgcgctgaaccagggcgaagtctgcacgtgcccatcgcgcgcg
ctcgtcgaggagagcatctacgatcgcttcatcgaacgcgcgctcaagcgcgtcgaggcg
atcaagcagggccatccgctcgattcgcagacgatgatcggcgcgcaggcgtcggccgag
cagctcgagaagatcctgtcgtacatcgacatcggccgcggcgaaggcgcgcaatgcctg
acgggcggcgagcgcaacgtgctcggcggcgagctcgccgaaggctattacgtgaagccg
accgtgttccgcggccacaacaagatgcgcatcttccaggaagaaatcttcgggccggtg
ctcgcggtgacgacgttcaagaccgaggaggaagcgctcgagatcgcgaacgacacgctg
tacggcctgggcgccggcgtctggacgcgcgacggcaaccgcgcgtaccgcttcggccgc
ggcatccaggcgggccgcgtgtggacgaactgctatcacgcgtatccggcgcacgcggcg
ttcggcggctacaagcaatccggcatcggccgcgagacgcacaagatgatgctcgaccac
taccagcagacgaagaacctgctcgtcagctacagcgaaaagccgctcgggttcttctga

DBGET integrated database retrieval system