KEGG   Burkholderia pseudomallei 1026b: BP1026B_II0164Help
Entry
BP1026B_II0164    CDS       T02049                                 

Definition
(GenBank) amylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz00500  Starch and sucrose metabolism
bpz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BP1026B_II0164
Enzymes [BR:bpz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BP1026B_II0164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N CBM_20 Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AFI68446
UniProt: A0A0H3HR82
LinkDB All DBs
Position
2:complement(186360..189005)
Genome map
AA seq 881 aa AA seqDB search
MSARHFGFKQAVLVGSLAALAGAAALPANTSAAEAFGSPGAAPVRGPAAKSFLGTAVNGA
SRVYFTGYRGILSEVYYPVLDTPESVDLQFLVGDAGKTFVDEEKQQAYSAAQTDTRTMSW
QVTTGNSSHNWQIRKIVFADPNHNAIVQRVTFTALNGRKVGDFNLYMLSKPYLDNAGANN
TAQTVSGSGGTALVANHNSRYSALVASRPWKVVNGVGMTSNGFVGQSDGWTDLLGGTADK
TMDWTFSSATNGNVAQMGWLDLGDPSATSVSFDVVLGFGGTQDQALGDANTVLGSDLAGE
QQQYDTGWHNYAAGLSSQNGAADDGYYLAAMTLKTMQDKSNGAMIAGIGTPWGETQGDAN
AGGYHLVWPRDLFKFANALTTAGDTSSATSVVNYLFNTLQQTTDCGTAEYNAPGCAQGYS
RVGRFPQNAWVNGWPYWQGTQMDEQAMPIILAWRLGPSVFNPLWPKIKLTADYIVNTGPW
TYQERWEENAGYSPSTIAAEIAGLVTAADIATQNGDTASAARYLAAADYWQENVAAWTYT
SSGAFGNGSYYIRINPAGRAGTGTDRASFAPTAGPDTPQTLSVKNGGGSHDARRVVDGGF
FELVRMGVKRATDPTIANTISVYDSVLGQTLNVANAPALSPNAWFRYNFDGYGEHNDGGD
FDGTGAGRLWPIFTAERGMVEIARQGSGGAGSAYFSTLKQLTTPEGFVPEQVWSNSTTLP
DGWAVTTPAGYTPGQPTKSMAPLNWAMGEYISLLASIQAGRIVDVPSVVCARYNNCAAPP
QSGQVPVAVNVNASTQLGQQMYVTGNVAALGNWNTDLGIPVDPASYPVWRNTVNLPAAQA
IQYKYYRKNADGSVTWENRSGNRQLQTPASGTLALNDQVSW
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaaggcacttcggattcaagcaggcggtgctggtgggcagtctggccgcgctc
gcgggcgcggcggccctaccggcgaatacttcggctgccgaagcattcggctcgcccggc
gccgcgcccgtgcggggcccggcggccaagtcgttcctcggcacggcggtcaacggcgca
tcgcgggtgtacttcaccggttatcgcggcatcctgtccgaggtctactacccggtcctc
gatacgcccgagtccgtcgacctgcagttcctcgtcggcgacgccggcaagaccttcgtc
gacgaagaaaagcagcaggcctactcggccgcgcaaacggacacgcgcacgatgagctgg
caggtgacgaccggcaacagttcgcacaactggcaaattcgcaagatcgtcttcgccgat
ccgaaccacaacgcgatcgtgcagcgcgtcacgttcaccgcgctcaacggccgcaaggtg
ggcgacttcaatctctacatgctgtccaagccgtacctcgacaacgccggcgccaacaat
accgcgcaaacggtgtccggcagcggcggcaccgcgctcgtcgcgaatcacaacagccgc
tattcggcgctcgtcgcgagccgcccgtggaaggtggtcaacggcgtgggcatgacgtcg
aacggcttcgtcgggcagagcgacggctggaccgacctgctcggcggcaccgccgacaag
acgatggactggaccttctcgtccgcgaccaacggcaacgtcgcgcagatgggctggctc
gacctcggcgatccgagcgcgacgagcgtgtcgttcgacgtcgtgctcggcttcggcggc
acgcaggaccaggcgctcggcgacgcgaacacggtgctcggcagcgatctcgccggcgag
cagcagcagtacgacaccgggtggcataactatgcggcgggcctgtcgtcgcagaacggc
gccgcggacgacggctactacctggccgcgatgacgctcaagacgatgcaggacaagagc
aacggcgcgatgatcgccggcatcggcacgccgtggggcgaaacgcagggcgatgcgaac
gcgggcggctatcacctcgtgtggccgcgcgacctgttcaagttcgcgaacgcgctgacg
acggcgggcgacacgtcgagcgcgacgagcgtcgtcaactacctgttcaacacgctgcag
cagacaaccgattgcggcaccgccgaatacaacgcgcccggctgcgcgcagggctacagc
cgcgtcgggcgctttccgcagaacgcatgggtgaacggctggccgtactggcagggcacg
cagatggacgagcaggcgatgccgatcatcctcgcgtggcgcctcggcccgagcgtgttc
aatccgctgtggccgaagatcaagctcaccgccgactacatcgtcaataccggcccctgg
acgtaccaggagcgctgggaggagaacgccggctattcgccgtcgacgatcgccgccgag
atcgcgggcctcgtcacggcggccgatatcgcgacgcaaaacggcgacacggcgagcgcc
gcgcgctacctcgccgcggccgactactggcaggagaacgtcgcggcgtggacgtacacg
tcgagcggcgcgttcggcaacggcagctactacatccggatcaatccggcgggccgcgcg
ggcaccggcaccgaccgcgcgagcttcgcgccgaccgccggccccgacacgccgcagacg
ctgagcgtgaagaacggcggcggcagccacgacgcgcggcgcgtcgtcgacggcggcttc
ttcgagctcgtccggatgggggtcaagcgcgcgaccgatccgacgatcgccaacacgatc
tcggtctacgacagcgtgctcggccagacgctgaacgtcgcgaacgcgccggcgctgtcg
ccgaacgcgtggttccgctacaacttcgacggctacggcgagcacaacgacggcggcgat
ttcgacggcaccggcgccggccggctgtggccgatcttcaccgccgagcgcggcatggtc
gagatcgcgcgccagggcagcggcggcgcgggcagcgcgtacttctcgacgctcaagcaa
ttgacgacgcccgagggcttcgtgccggagcaggtgtggtcgaattcgacgacgctgccc
gacggctgggcggtgacgacgcccgcgggctacacgccgggccagccgaccaaatcgatg
gcgccgctcaactgggcgatgggcgaatacatcagcctgctcgcgtcgatccaggcgggg
cgcatcgtcgacgtgccgtcggtggtctgcgcgcgctacaacaactgcgccgcgccgccg
caaagcgggcaggtgccggtggccgtcaacgtgaacgcgagcacgcagctcggccagcag
atgtacgtgacaggcaacgtcgccgcgctcggcaattggaacaccgatctcggcattccg
gtcgatccggccagctacccggtgtggcgcaacaccgtcaacctgccggccgctcaggcg
atccagtacaagtactaccggaagaacgcggacggcagcgtgacgtgggagaaccgttcc
ggcaaccgccagcttcagacgcccgcgagcggcacgttggcgctgaacgatcaggtgagc
tggtga

DBGET integrated database retrieval system