KEGG   Burkholderia pseudomallei 1026b: BP1026B_II2406Help
Entry
BP1026B_II2406    CDS       T02049                                 

Definition
(GenBank) DNA glycosylase
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:bpz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    BP1026B_II2406
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bpz03400]
    BP1026B_II2406
Enzymes [BR:bpz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     BP1026B_II2406
DNA repair and recombination proteins [BR:bpz03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     BP1026B_II2406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: AFI70615
UniProt: A0A0H3I0A1
LinkDB All DBs
Position
2:2971808..2972464
Genome map
AA seq 218 aa AA seqDB search
MARDARAAHSSRRRRAADDDDAPQTLDACRRCGLWEHATQAVPGAGPPRAAIMLVGEQPG
NQEDREGAPFVGPAGRVLERALAAAGLDRASVYVTNAVKHFKWAPRGKRRMHKTPAQQEI
DACRYWLERELDALGPRVVVALGAIALKAVLDDRHARLQSAMGVVQPAGGRYVIATYHPS
FVLRVPDPDARKRAYAAIVEACRIAHELAQRTDGAPRP
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcgacgctcgcgccgcgcattcgtcgcgccgccgccgtgcggcggacgacgac
gacgcgccgcagacgctcgatgcgtgccgccgttgcgggctctgggagcacgcgacgcag
gcggtgcccggtgcgggcccgccgcgcgcggcgatcatgctcgtcggcgaacagccgggc
aatcaggaagaccgcgagggcgcgccgttcgtcggcccggccgggcgcgtgctcgagcgc
gcgctcgcggcggcggggctcgaccgcgcgagcgtctacgtgacgaacgcggtcaagcac
ttcaaatgggcgccgcgcggcaagcggcggatgcacaagacgcccgcgcagcaggaaatc
gatgcgtgccggtattggctcgagcgcgaactggacgcgctcgggccgcgcgtcgtcgtc
gcgctcggggccatcgcgctgaaggccgtgctcgacgatcgccacgcgcggctgcagtcc
gcgatgggcgtcgtgcaaccggcgggcggccgctatgtgatcgcaacctaccacccgtcg
ttcgtgctgcgcgtgcccgatcccgacgcgcgcaagcgcgcgtacgcggcgatcgtcgaa
gcgtgccgcatcgcgcacgagctcgcgcagcgcacggacggcgcaccccggccctga

DBGET integrated database retrieval system