KEGG   Burkholderia pseudomallei 1026b: BP1026B_II2435Help
Entry
BP1026B_II2435    CDS       T02049                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz00020  Citrate cycle (TCA cycle)
bpz00190  Oxidative phosphorylation
bpz00650  Butanoate metabolism
bpz01100  Metabolic pathways
bpz01110  Biosynthesis of secondary metabolites
bpz01120  Microbial metabolism in diverse environments
bpz01130  Biosynthesis of antibiotics
bpz01200  Carbon metabolism
Module
bpz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bpz_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bpz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BP1026B_II2435
   00650 Butanoate metabolism
    BP1026B_II2435
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BP1026B_II2435
Enzymes [BR:bpz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BP1026B_II2435
    1.3.5.4  fumarate reductase (quinol)
     BP1026B_II2435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4_4
Motif
Other DBs
NCBI-ProteinID: AFI70644
UniProt: A0A0H3HW63
LinkDB All DBs
Position
2:complement(3006121..3006834)
Genome map
AA seq 237 aa AA seqDB search
MTMADTRILDIYRYDPDDGRAPRMQRYELAPRAEDRMLLDVLGRVKAQDETLSYRRSCRE
GVCGSDAMNINGRNGLACVTSMQALPREIVLRPLPGLPVVRDLIVDMTSFFNQYHSVRPY
LVNEGVPPERERLQTPQEREQLDGLYECILCACCSSACPSYWWNPDKFVGPAGLLQAYRF
IVDSRDDASAARLDDLEDPYRLFRCRTIMNCVDVCPKGLNPARAIGQIRTMLARRAV
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgacgatggccgacacccgcattctcgacatctaccgctacgatccggacgacgggcgc
gcgccgcgcatgcagcgctatgagctcgcgccgcgcgcggaagaccggatgctgctcgac
gtgctcggccgcgtgaaggcgcaggacgagacgctgtcgtatcgccgctcgtgccgcgag
ggcgtgtgcggctccgacgcgatgaacatcaacggccgcaacgggctcgcctgcgtgacg
agcatgcaggcgctgccgcgcgaaatcgtgctgcggccgctgccggggctgcccgtcgtg
cgcgatctgatcgtcgacatgacgagcttcttcaatcagtaccattcggtccgcccgtat
ctcgtcaacgaaggcgtgccgcccgaacgagagcgcctgcagacgccgcaagagcgcgag
cagctcgacggcctctacgaatgcatcctgtgcgcgtgctgctcgagcgcatgcccgagc
tactggtggaatcccgacaagttcgtcgggccggcggggctgctgcaggcgtaccgcttc
atcgtcgattcgcgcgacgacgcgagcgccgcgcgcctcgacgatctcgaggacccgtac
cggctgttccgctgccggaccatcatgaactgtgtcgatgtctgtccgaaaggcctgaac
ccggcgcgcgcgatcggacagatccgcacgatgctcgcgcggcgcgcggtatag

DBGET integrated database retrieval system