KEGG   Bacillus amyloliquefaciens LL3: LL3_00455Help
Entry
LL3_00455         CDS       T01835                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
bql00473  D-Alanine metabolism
bql00550  Peptidoglycan biosynthesis
bql01100  Metabolic pathways
bql01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bql00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LL3_00455 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LL3_00455 (ddl)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    LL3_00455 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bql01011]
    LL3_00455 (ddl)
Enzymes [BR:bql01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LL3_00455 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:bql01011]
 Precursor biosynthesis
  Amino acid ligase
   LL3_00455 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST GARS_A ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AEB62003
LinkDB All DBs
Position
452443..453528
Genome map
AA seq 361 aa AA seqDB search
MKTSLGLVYGGKSAEHNVSLQTALAVTKALNTDKFDIHPIYITEKGEWQRGPLLTEPVSN
VKMLQLEQNGESFALSALNREMFPEASADEKAPIDVVFPLLHGPNGEDGTIQGLLELLNV
PYVGNGVLASSAGMDKVIMKHLFAQAGLPQAKYAAFLKKDWKQTPDSCLQQVEEELGYPC
FVKPANLGSSVGISKCRNREELEKAFELAFEYDRKIVVEEGIAGREIEIGVLGNDEPKCS
AVGEIAPKTDFYDYKAKYEDGDTDLMIPAQVTDEQYAEISEMAIKAFKAIDGSGLVRADF
FLTNDGQVLINEVNTMPGFTPFSMFPLLWKEAGVDYSDLIEQLVELAKERHAEKQLIKHT
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacaagtctaggattggtgtacggcggaaagtcagctgaacacaatgtatcgctt
cagacagcacttgctgtaacaaaagcgcttaatactgataagtttgatatacatccgatt
tacatcacggaaaaaggagaatggcaaagaggtccgcttctgactgaaccggtttccaac
gtgaaaatgctgcagctggaacaaaatggtgaaagtttcgctctttccgcattgaaccgg
gaaatgtttcctgaagcgtcggctgatgaaaaggcgccgattgacgtcgttttcccgctt
ctccacggaccgaacggtgaggacggcacgatccagggccttcttgaattgctgaacgtt
ccttatgtcggcaacggagtgcttgcgtcatcagcgggcatggataaagtcatcatgaag
catttgttcgctcaagcggggcttccgcaggcgaagtacgccgctttcttaaaaaaggat
tggaaacagactccggacagctgcttacagcaggttgaagaggaactggggtatccatgc
tttgtcaaaccggcgaacctcggttcaagtgtcggaatcagcaaatgccgaaaccgcgaa
gagcttgaaaaagcctttgaactggcttttgagtatgaccggaaaattgttgtcgaagaa
ggaatcgccggcagagaaattgaaatcggcgtgctcggaaatgacgaaccgaaatgctcc
gccgtcggtgaaatcgcgccaaaaaccgatttttacgactacaaagcgaaatacgaagac
ggcgacacggatttaatgattcccgcgcaagtgacggatgaacaatacgcggaaatcagc
gagatggcgattaaagccttcaaagcgattgacggctcaggccttgtccgcgccgatttc
ttcctgaccaatgacggtcaagtgctcattaacgaagtgaacacaatgccgggctttacg
ccattcagcatgttcccgctgctatggaaagaagccggcgtagattacagtgatctgatt
gaacagcttgttgagctggcaaaagagcgccatgccgagaaacagctgattaaacataca
ttttaa

DBGET integrated database retrieval system