KEGG   Bacillus amyloliquefaciens LL3: LL3_00672Help
Entry
LL3_00672         CDS       T01835                                 

Definition
(GenBank) hypothetical protein
Organism
bql  Bacillus amyloliquefaciens LL3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transglut_core DUF4129 Transglut_core3
Motif
Other DBs
NCBI-ProteinID: AEB62219
LinkDB All DBs
Position
633631..635838
Genome map
AA seq 735 aa AA seqDB search
MPHDENQGSRLSLLLFYFLAFLLLWEWLRPLHNFTDTKHTGFFIIFIGLAFLLSFFRMRW
YVTVPSCILFTLISIHMLFYKGSVFQPEWLASFLRDVMLNARHIGTGRWNDMNPSFRTLL
FFVLLWLLVYLLHYWVIYQRKILFFFIMTVAYITVLDTFTPYDAAYAVIRIVFIGFLMMG
LLNMERIRLTEHIAFKKRLIIKWFLPLALFICASVLFGLAAPKSDPNWPDPVPFLKKITN
HKEVPAAESKIGYGNHDETLGGPFQQDDTPVFTWKGKERAYFRVETKDTYTGKGWVETDQ
GMSYKLNGGNVEDIWFDRSVQTRRYTAQVSIDENYLYNHVMYPIGVSNIKPKHSIQLEMN
GNTEQITPISEQVGSIRNMGRYTVTFHAPVFKLNDLKKVKVKRYREQNQFNDRYLQLPDS
LPERVRQLADRLTRDHHNMFDKAKAVEDYLGSSAFSYDTQDVAVPEHNQDYVDQFLFETK
RGYCDNFSSAMAVLLRSAGIPARWVKGYTSGEYKGAGDQNGHLYEVTNNNAHSWVEVYFP
DQGWVTFEPTKGFTNPTEFTSEQNHTAGKDGGSSAGNSDTPSDKQRQETKPEKKETPKKR
EHSAAPHPVMHNKTAAQLWPYAAIIIVISAAAALVWVLRARWIPHVAAARLKRRTDEDVF
FDAYAALLRQLKRKGFSRGDGETLRDFAARIDEAYHTDDMSELTLRYERALYRSDNAAEL
WNESVQLWENIIKTR
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgccgcatgacgagaaccagggaagcaggctgagtctgctgctgttttattttctcgct
tttttattgttatgggaatggctcaggccgctgcacaattttacggatacaaaacatacc
ggttttttcatcatttttatcggtttggcatttctgctgtcattcttccggatgaggtgg
tacgtcaccgtgccgtcctgcattctgtttacgttgatcagtattcatatgctgttttat
aaaggttcggtttttcagccggaatggctcgcttcttttttgcgggacgtgatgctgaat
gcccggcacatcgggaccggaagatggaatgatatgaacccgtcattccgcacattgctg
ttttttgtgctattatggctgctcgtatatttactgcattactgggtgatctatcagcgg
aaaatattattcttttttatcatgacggtggcctatatcaccgtgcttgatacgtttact
ccctatgatgccgcatacgccgtcatccggattgtctttatcggctttttgatgatgggg
cttttgaatatggagcgcatccgcctgacggaacacatagcgtttaaaaaaaggttgatc
atcaaatggtttctgccgctggcgctgtttatctgcgcttccgtcctattcggtctggcg
gctccgaaatcagatccgaactggccggaccccgtgccgtttctgaaaaaaataacaaat
cacaaagaggtgcccgccgctgagagcaaaatcggctacggcaaccatgatgaaacatta
ggcgggccttttcagcaggacgatacgccggttttcacatggaagggaaaagagcgggcg
tacttccgggtggaaacgaaggatacatacacgggaaaaggctgggtggagaccgatcag
ggcatgtcctataaactgaatggcggcaatgtggaagatatatggtttgaccggagtgtg
cagacgagacgttatacggcgcaggtgtccattgatgagaattatctttataatcacgtc
atgtatccgatcggcgtctccaatattaaaccgaagcactcgattcagcttgaaatgaac
ggaaacaccgagcaaatcacgccgatcagtgaacaagtgggcagcatccgcaatatggga
cggtacacggtgacttttcacgcgcccgtctttaaactgaatgacctcaaaaaagtgaaa
gtgaaacgataccgtgagcagaatcaattcaatgaccggtatctgcagcttcccgacagc
cttccggaaagagtgagacagcttgccgacaggctgacgcgggatcatcataatatgttc
gataaagcgaaggcggtcgaggattatctgggatcttccgcattttcgtatgatacacag
gatgtcgccgttccggagcacaaccaggattatgtggatcaatttttgtttgaaacgaaa
agaggttattgtgataacttttcttcggcaatggctgtgctgctgcgatctgcgggaatt
cccgcccgctgggtgaaaggctatacatccggagaatataaaggcgcgggcgatcaaaac
ggccatctttatgaagtcacaaacaacaatgcccattcgtgggtagaagtatattttccg
gatcagggctgggtgacgtttgagccgacgaaaggcttcaccaatccgacggagtttacg
tcagagcagaatcatacagcgggaaaagatggcggaagctcagcggggaattcggataca
ccgtctgacaagcagcgccaggaaacaaagcccgaaaaaaaagaaacgccgaaaaagcgg
gagcacagtgcggctccgcatcctgtgatgcacaataaaaccgcggcacagctgtggccg
tatgcagctatcatcatcgtgatttcagccgcggccgcgctcgtctgggtgctgcgggcg
cgctggattccgcatgttgcagcagccagattgaagcggcgcacggatgaagacgtcttt
ttcgacgcatatgccgcgctgctccgccagctgaaacgaaaagggttcagcaggggagac
ggagaaacgctccgtgattttgccgcgaggattgatgaggcgtaccatacagacgacatg
tccgagctgacgctgcgctatgagcgtgctttataccgcagcgataatgccgcagagctt
tggaatgaatcggtacagttgtgggaaaatataattaaaacaagatag

DBGET integrated database retrieval system