KEGG   Bacillus amyloliquefaciens LL3: LL3_00756Help
Entry
LL3_00756         CDS       T01835                                 

Gene name
yfmT
Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
bql00627  Aminobenzoate degradation
bql01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bql00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    LL3_00756 (yfmT)
Enzymes [BR:bql01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     LL3_00756 (yfmT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEB62301
LinkDB All DBs
Position
717586..719043
Genome map
AA seq 485 aa AA seqDB search
MFQYEELNKQFIGGRWRDGSSRNVLEDRNPYTQKVITSFRKATPDDVDAAYRAAALAKQE
WDKVNPFKKRAILEKAVSFIEEHEEAIVYLIMEELGGTRLKAEFEIGLVKNMIKEAATFP
VRMEGKILPSTIDGKENRLYRIPAGVVGVISPFNFPFFLSMKSVAPALGAGNGVVLKPHE
ETPICGGTLIAKIFEAAGVPDGLLNVIVTDIGEIGDSFVEHPVPRIISFTGSTGVGSYIG
QLAVKHFKKPLLELGGNSALIVLEDADLEYAVNAAVFSRFTHQGQICMSANRVLVHTSVY
DKFTELYEAKVSSLKVGDPMDPDTVIGPLINERQAEGLKRSVEKAIEEGAVPVLSGRFSG
TIAEPVILKDVKPDMSIAKEELFGPAVCIMPFETEDEAVSIANATPFGLSGAVHTANVER
GVEFAKRIETGMIHVNDTTINDEPNVAFGGEKQSGLGRLNGEWSLEEFTTLKWISVQHEK
RQFPY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaatatgaagaactaaataagcagtttatcggcggccgatggagggatggaagc
agccggaacgtattggaagacagaaatccttatactcagaaagtcatcacctcattccga
aaagcgacgcctgatgatgtggatgcggcgtaccgtgccgcggctcttgcgaaacaagaa
tgggacaaagtaaacccttttaaaaagcgggccattttggaaaaagcggtatctttcatc
gaagagcatgaagaagcgattgtttacttaatcatggaggaacttggcggaacaagactg
aaggctgagtttgaaatcggacttgttaaaaatatgataaaagaagccgcaacatttccg
gtgcggatggaagggaaaattctcccgtcgacgattgacggaaaagaaaacaggctgtac
agaatacccgccggagtcgtcggggtgatcagcccgtttaatttcccgtttttcctttca
atgaaatctgttgcgccggcactcggcgcggggaacggcgttgtattgaagcctcatgaa
gaaacaccgatctgcggcggcacgcttatcgcgaaaatttttgaagcggccggcgtaccg
gacgggctgctgaacgtcatcgttacggatatcggggagatcggcgacagctttgtcgaa
catcccgtgccgcgaattatctcatttacaggttcaacaggggtaggcagctatatcgga
cagcttgcggttaaacactttaaaaaaccgctgttggagcttggcggaaacagcgctctg
atcgtgcttgaggatgctgatctcgaatacgccgtcaatgcggccgtattcagccggttt
acgcatcagggccagatctgcatgtcggcgaaccgcgtgctcgttcacacgtctgtatat
gacaaatttacagagctttacgaagcgaaagtgtcatcgctgaaagtcggcgatccgatg
gaccctgatacggttatcgggcctttaatcaatgagagacaggcggaaggtttaaaacgg
tctgttgaaaaggcgatagaagagggagcggttccggtcttgtccggccgattcagcgga
acgatcgctgaacctgtcatcttaaaagatgtgaagcctgatatgagcatcgcgaaggag
gaactgttcggcccggccgtctgcatcatgccgtttgaaacggaggatgaagctgtcagc
atcgcaaacgcgacaccgttcggtttaagcggagccgtgcatacggcaaacgttgagcgg
ggcgttgagtttgcaaagcggatcgagaccggcatgattcacgtcaatgatacgaccatt
aatgatgaaccgaatgtcgcgttcggcggcgagaagcaatcaggtctcggcaggctgaac
ggcgaatggagccttgaagaattcaccacgctgaaatggatttcggttcagcatgaaaaa
cggcaattcccatattaa

DBGET integrated database retrieval system