KEGG   Bacillus amyloliquefaciens LL3: LL3_02352Help
Entry
LL3_02352         CDS       T01835                                 

Gene name
yomY
Definition
(GenBank) SPBc2 prophage-derived uncharacterized protein yomY
Organism
bql  Bacillus amyloliquefaciens LL3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YojJ DUF1129
Motif
Other DBs
NCBI-ProteinID: AEB63887
LinkDB All DBs
Position
2238137..2238391
Genome map
AA seq 84 aa AA seqDB search
MSMIQVKSVLNNGQIKIEELDVYCNTLSKKNNSVLFKLEKYLNKKLLSDPDLIEIRDTIL
TVSGELNRLNDCLLTDGDSIEGLQ
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgattcaagttaaatcggtattaaacaatggacaaattaagattgaagaatta
gacgtgtattgcaatacgctcagcaagaaaaacaattcggtacttttcaaattggagaaa
taccttaacaaaaagctactgagtgaccctgaccttatagaaatcagagacactatttta
acagtaagtggtgagttaaacaggcttaatgattgcttattgacagacggtgattcaatt
gaaggattacagtaa

DBGET integrated database retrieval system