KEGG   Bacillus amyloliquefaciens LL3: LL3_02698Help
Entry
LL3_02698         CDS       T01835                                 

Gene name
sodA
Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bql  Bacillus amyloliquefaciens LL3
Brite
Enzymes [BR:bql01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     LL3_02698 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AEB64231
LinkDB All DBs
Position
complement(2534035..2534640)
Genome map
AA seq 201 aa AA seqDB search
MAYKLPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAIEGSALAEKSVDELVADL
NAVPEDIRTAVRNNGGGHANHSLFWTLLSPNGGGEPTGELAEEIKSTFGSFDQFKEKFAA
AAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRPDY
ISAFWNVVNWDEVARLYSEAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcttacaaacttccagaattgccttacgcttatgatgctttagaaccgcatatcgat
aaggaaacgatgacgattcaccatacgaagcaccataacacatacgttacaaacctgaac
aaagcgatcgaaggatcagcgcttgcagagaaatccgtagatgagcttgttgctgattta
aacgcagtgccggaggatatccgcacggctgtccgcaacaatggcggcggacatgcgaac
cactctttattctggactcttttatctccgaacggcggaggcgaaccgactggtgagctt
gctgaagagatcaaaagcacattcggaagcttcgatcaatttaaagaaaaattcgctgca
gcagctgccggccgtttcggttctggctgggcttggcttgttgtaaacaacggcaaactt
gaaattacaagcacgccaaaccaagattcaccgctttcagaaggcaaaacgcctatcctc
ggtcttgacgtttgggagcacgcttactacctgaactaccaaaaccgccgtcctgattac
atttcagctttctggaatgttgtgaattgggatgaagttgcccgtctttacagcgaagca
aaataa

DBGET integrated database retrieval system