KEGG   Bacillus amyloliquefaciens LL3: LL3_03001Help
Entry
LL3_03001         CDS       T01835                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
bql00020  Citrate cycle (TCA cycle)
bql00480  Glutathione metabolism
bql01100  Metabolic pathways
bql01110  Biosynthesis of secondary metabolites
bql01120  Microbial metabolism in diverse environments
bql01130  Biosynthesis of antibiotics
bql01200  Carbon metabolism
bql01210  2-Oxocarboxylic acid metabolism
bql01230  Biosynthesis of amino acids
Module
bql_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bql_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bql00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LL3_03001 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LL3_03001 (icd)
Enzymes [BR:bql01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     LL3_03001 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AEB64532
LinkDB All DBs
Position
complement(2817796..2819067)
Genome map
AA seq 423 aa AA seqDB search
MSQGEKITVSNGVLNVPNNPIIPFIEGDGTGPDIWNAASKVLEAAVEKAYKGEKKITWKE
VYAGEKAYNKTGEWLPAQTLEDIREYFIAIKGPLTTPVGGGIRSLNVALRQELDLFTCLR
PVRYFTGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGSEEVEKLISFLQNEMGVNKIR
FPETSGIGIKPVSEEGTSRLVRAAIEYAIENGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EREYGDKVFTWAEYDRIVEKDGKEAADKAQSEAEAAGKIIVKDSIADIFLQQILTRPSEF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVLLLEHLNWNEAADLIIKSMEKTIASKVVTYDFARLMDGATEVKCSEFGEELIK
NMD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgtcacaaggtgaaaaaattacagtctctaatggagtattaaacgtaccaaataatccg
atcatcccgtttattgaaggcgacggcacaggccctgatatttggaatgccgcttctaaa
gttttggaagccgctgttgaaaaagcatataaaggcgagaaaaaaatcacgtggaaagaa
gtttatgccggtgaaaaggcttataataaaacaggtgaatggctccctgcccaaacgctg
gaagacatcagagagtacttcatcgcgatcaaagggcctctgacgacacctgtcggcggc
ggtatccgttctttgaacgtagcgctgagacaggagcttgatttgtttacgtgtctgcgc
cctgtcagatatttcacaggagtgccttctccggtcaaacgccctgaagatacagatatg
gtcattttccgcgaaaatacagaagatatttacgccggaattgagtatgcgaaaggttct
gaagaagttgaaaagctgatcagcttcctgcaaaatgaaatgggcgttaacaaaatccgt
ttccctgaaacatcaggaatcggaatcaagcctgtttctgaagaaggaacaagccgctta
gtcagagccgccattgagtatgcgatcgaaaacggccgtaaatctgttacacttgtccac
aaaggaaacatcatgaagttcactgaaggggcatttaaaaactggggctacgagcttgct
gaaagagaatacggagataaagtattcacttgggctgaatatgaccgcattgtcgaaaaa
gacgggaaagaagcagctgataaagcgcagagcgaagcggaagcagcagggaaaatcatc
gtcaaagacagcatcgctgatattttccttcagcagatcttaacccgcccgagcgaattc
gacgtcgtggcgacaatgaacttaaacggagactatatctctgatgcgcttgccgctcag
gtaggcggaatcggaatcgcgccgggagcgaacatcaactatgaaacagggcatgcgatt
ttcgaagcgactcacggaacggctcctaaatatgccggccttgacaaggtcaacccgtca
tccgtcatcctttcaggagtgcttcttcttgaacacctgaactggaatgaggctgctgac
ttgatcattaaatctatggaaaaaacgattgcttcaaaagtagtaacgtacgattttgct
agattaatggacggtgcaaccgaagtgaaatgttcagagttcggtgaagagctcatcaaa
aacatggactga

DBGET integrated database retrieval system