KEGG   Bartonella quintana RM-11: RM11_0367Help
Entry
RM11_0367         CDS       T02294                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bqr  Bartonella quintana RM-11
Brite
Enzymes [BR:bqr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     RM11_0367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF1007
Motif
Other DBs
NCBI-GeneID: 13563242
NCBI-ProteinID: AFR26107
LinkDB All DBs
Position
complement(471801..472403)
Genome map
AA seq 200 aa AA seqDB search
MAFELAKLPYDYDALSPYMSRETLEYHHDKHHLAYLTNTNNFVKDLGLENESLEHIVKKS
FGQNIGLFNNAAQYYNHNHFWHWMKKGGGGQKLPEKLAKAIESDLGGYNKFRADFIAAAV
AQFGSGWAWVAVKDGKLEIMKTSNSENPLVHDAQPILGVDVWEHSYYIDYRNARPKYLEA
FVDNLINWDYVLKLYEDCGF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattggctaagttgccttatgattatgatgccctttcgccttatatgtca
cgcgaaacacttgaatatcaccatgataagcatcacctcgcttatcttaccaataccaac
aattttgtgaaagatttaggcttagaaaatgaaagccttgaacatattgttaaaaaaagc
tttggacagaatattggtttgtttaataatgcagcccaatattacaaccataatcatttt
tggcattggatgaaaaaaggtggtggtggtcaaaaactgcctgaaaaattagcaaaagct
attgaatctgatctgggtggttataataagttccgggcagattttattgccgccgccgtt
gcccaatttggttctggatgggcatgggtcgctgttaaagatggtaaacttgaaattatg
aaaacatctaatagtgaaaatcctttagttcatgatgcgcaacctattctgggtgttgat
gtgtgggaacattcctattatattgactatcgcaatgcgcgcccaaaatatcttgaagct
tttgtggataatttaattaattgggactatgttttaaaactttatgaagattgtggattt
taa

DBGET integrated database retrieval system