KEGG   Bartonella quintana Toulouse: BQ03820Help
Entry
BQ03820           CDS       T00181                                 

Gene name
sodB
Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bqu  Bartonella quintana Toulouse
Brite
Enzymes [BR:bqu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BQ03820 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CAF25882
UniProt: A0A0H3LTP4
LinkDB All DBs
Position
complement(472301..472903)
Genome map
AA seq 200 aa AA seqDB search
MAFELAKLPYDYDALSPYMSRETLEYHHDKHHLAYLTNTNNFVKDLGLENESLEHIVKKS
FGQNIGLFNNAAQYYNHNHFWHWMKKGGGGQKLPEKLAKAIESDLGGYNKFRADFIAAAV
AQFGSGWAWVAVKDGKLEIMKTSNSENPLVHDAQPILGVDVWEHSYYIDYRNARPKYLEA
FVDNLINWDYVLKLYEDCGF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattggctaagttgccttatgattatgatgccctttcgccttatatgtca
cgcgaaacacttgaatatcaccatgataagcatcacctcgcttatcttaccaataccaac
aattttgtgaaagatttaggcttagaaaatgaaagccttgagcatattgttaaaaaaagc
tttggacagaatattggtttgtttaataatgcagcccaatactacaaccataatcatttt
tggcattggatgaaaaaaggtggtggtggtcaaaaactgcctgaaaaattagcaaaagct
attgaatctgatctaggtggttataataagttccgggcagattttattgctgccgccgtt
gcccaatttggttctggatgggcatgggtcgctgttaaagatggtaaacttgaaattatg
aaaacatctaatagtgaaaatcctttagttcatgatgcgcaacctattctgggtgttgat
gtgtgggaacattcctattatattgactatcgcaatgcgcgcccaaaatatcttgaagct
tttgtggataatttaattaattgggactatgttttaaaactttatgaagattgtggattt
taa

DBGET integrated database retrieval system