KEGG   Bartonella quintana Toulouse: BQ06360Help
Entry
BQ06360           CDS       T00181                                 

Definition
(GenBank) hypothetical protein
  KO
K07447  putative holliday junction resolvase [EC:3.1.-.-]
Organism
bqu  Bartonella quintana Toulouse
Brite
KEGG Orthology (KO) [BR:bqu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BQ06360
Enzymes [BR:bqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     BQ06360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvX
Motif
Other DBs
NCBI-ProteinID: CAF26127
UniProt: Q6FZS7
LinkDB All DBs
Position
749587..750066
Genome map
AA seq 159 aa AA seqDB search
MAVININEVITHLLPGQTIAGLDLGKKTIGIAVSDRGLTFSNPRSVLQRKKLTVDARTLI
QIFDRENVGVVIIGLPLNMNGSSGPRAQATRTFVNNMEAYTEIPFVFWDERLSTIAAERS
LLEMDVSRAKRATRIDSAAAAFILQGALNRIQNLHYMEG
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggccgttattaacataaatgaagttattacacatcttttgcctgggcaaacaatagca
ggtttggatttgggtaaaaaaacgatcggaattgcagtttctgatagaggactaactttt
tcaaatccgcgttctgtactccaacggaaaaaacttacggtagatgcccgcacacttata
caaatttttgatcgtgaaaatgtgggggttgttatcattggtttacctcttaacatgaat
ggaagcagcggccctcgtgctcaagcaaccagaacttttgtcaacaatatggaagcgtat
acagaaattccatttgttttttgggatgaacgcttatcgacgattgcggcggaacgctct
cttttagaaatggatgtatcacgtgctaaaagagcaaccaggattgattctgctgctgct
gcattcatattgcaaggggctctcaatagaattcaaaaccttcattatatggaaggataa

DBGET integrated database retrieval system