KEGG   Bacillus amyloliquefaciens Y2: MUS_0079Help
Entry
MUS_0079          CDS       T02108                                 

Gene name
hslO
Definition
(GenBank) HSP33-like chaperonin
  KO
K04083  molecular chaperone Hsp33
Organism
bqy  Bacillus amyloliquefaciens Y2
Brite
KEGG Orthology (KO) [BR:bqy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bqy03110]
    MUS_0079 (hslO)
Chaperones and folding catalysts [BR:bqy03110]
 Heat shock proteins
  HSP33
   MUS_0079 (hslO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AFJ60169
UniProt: I2C0J5
LinkDB All DBs
Position
80785..81660
Genome map
AA seq 291 aa AA seqDB search
MDYLIKAIAYDGKVRAYAARTTDMVNEAQRRHDTWPTASAAIGRTMTASLMLGAMLKGED
KLTVKIEGGGPIGAIVADANAKGEVRAYVSNPHVHFDLNEQGKLDVRRAVGTDGTLSVVK
DLGLRDYFTGQVEIVSGELGDDFTYYLVSSEQVPSSVGVGVLVNPDNTILAAGGFIIQLL
PGTDEETISTIEKQLSQIEPISKLIQKGLTPEEILEEVLGQKPDVLETMPVKFHCSCSKD
RFETAILGLGKKEIQDMIEEDGKAEAVCHFCNEKYLFTKEELEELRDETTR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggattatttaattaaagcaattgcatatgacggtaaagtgcgggcttatgcagccaga
acgacagatatggttaatgaagcgcaaagaaggcatgacacgtggccgacggcatcagcc
gcaatcggccggacgatgacagcttctctgatgctcggagcgatgcttaagggtgaagat
aagctgacagtcaaaatagaaggcggcggcccgatcggagccattgtcgcagatgcgaac
gcaaagggtgaggtaagagcatacgtatcaaacccgcacgttcattttgacctcaatgaa
caagggaaactggatgtcagacgggcggtcggaactgacggaacactcagtgtcgtaaaa
gatttgggcttgcgtgattattttacgggacaagtagagattgtctcgggtgaactcggt
gacgacttcacgtattaccttgtttcttctgaacaagtcccttcatctgtcggcgtaggt
gttctggtaaatcctgataacacgattctcgctgcgggcgggttcatcattcagcttctt
ccggggactgatgaagaaaccatttcaacaattgagaagcaattatctcaaatcgaaccg
atttcaaaattgattcaaaaaggcctgacaccggaagaaatcttagaagaagttctgggt
caaaaaccggacgttctcgaaacaatgccggtcaaatttcactgttcttgttcaaaagat
cgattcgaaacggccattttaggactaggcaaaaaagaaatacaagatatgatagaagaa
gacggaaaagccgaagcggtttgccatttttgtaatgagaaatatttatttacaaaagaa
gaactggaagagcttcgtgacgaaacaacccgctag

DBGET integrated database retrieval system