KEGG   Bacillus amyloliquefaciens Y2: MUS_0345Help
Entry
MUS_0345          CDS       T02108                                 

Definition
(GenBank) conserved hypothetical protein YclG
Organism
bqy  Bacillus amyloliquefaciens Y2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_helix NosD Pectate_lyase_3
Motif
Other DBs
NCBI-ProteinID: AFJ60427
UniProt: I2C1A3
LinkDB All DBs
Position
365221..366999
Genome map
AA seq 592 aa AA seqDB search
MTIREEGGDYHLPNRILDITDCGVAADGKTDVTGAINQCLARAVSEGCHTVFFPPGTYKI
NGTLGGDRSQPFRNAGINVPSHLTIVLDPECTIKVAPNSSWGYSAFYIGRRENVTITGGR
IIGERDEHTYTNVPLRSTHEWGFGICIEGSSNVLIENVKISDFTGDGIIVSPLGLKTNSD
YETSEQVTIRRCEIRQSRRNNISITGCNTVTVEECVIEDAGQGNGTAPKFGIDIESYGEG
DIDYEEALHITVRNNFFSGNAASSVTNFNGYNVLIEGNHSDNTISYGYGAHTVISGNVFF
RSDGGSRTAVAGQGVSQGQDSSNAVISNNLITGFSTGIDVRGKSVLVTHNKINQFENTGI
SVYQAEDVTVDGNVIENGRSETRRSTGMRATLSENAVFTNNTLNQVTDGISMSAGNITVK
QNVLTSFSRGIWVTGGNAVIEGNTLIPNAYQGAAESYAVSVTNDARAVIKGNLFKNYKNY
PVFSSTSSGTSVISNRFESSPLIVTVYLNSGTHEVIDNTLTINRTAGSPIGIYLNGASNS
LVSGNTINNLSAASASAIQTNSSASTKIIGNRIIKGVIVKHTTDTESGNIVI
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgacaataagagaggaaggaggagattatcacttgccgaatcgtatattggatattacg
gattgcggtgtggcggcagacggaaaaaccgacgtgacgggcgccatcaaccaatgcttg
gccagggccgtcagcgaaggctgtcatacggtgttttttccgcccggaacgtataaaatc
aacggcacgcttggcggggacagaagccagccgtttcggaacgccgggattaacgtgccg
agccatctcaccatcgttttagatccggaatgcacgattaaagtggcgccgaacagctcc
tggggctactcggctttctatataggcaggcgtgaaaatgtcaccatcaccggcggccgg
atcatcggggaacgggatgaacacacgtataccaatgtccctttgcggtcgacccatgaa
tgggggtttggaatctgtattgaaggcagcagcaatgtgctgatcgaaaatgtgaagatt
tccgattttacgggagacggcattattgtcagcccgctcgggttaaaaacaaacagtgat
tacgaaacttcagaacaggtgaccatccgccgctgtgagatcaggcagtcaaggcggaac
aacatttcaatcaccggctgcaataccgttacggtggaagaatgtgtaattgaagacgcc
gggcaagggaacggaacggctccgaaattcggaatcgatattgaatcgtacggagaaggc
gatattgattatgaagaagctcttcatattacggtccgcaacaactttttttccggaaac
gccgcaagctcagtcaccaactttaacggatataatgtgttaattgaaggaaatcattcc
gataacacaatcagctacgggtatggggcacataccgtcatttcggggaatgttttcttt
cggtcagacggcggctcaaggaccgcagttgccggacaaggtgtgtcacaaggacaggac
agcagcaatgccgtcatttccaacaatctgattaccggtttttccaccggaatagatgta
aggggaaaaagcgtcctcgtcacccataacaaaatcaatcaatttgaaaatacgggcatt
tccgtctatcaggcagaagatgtgaccgttgacggcaatgtcattgaaaacggacgttcc
gaaacgagacgaagcacggggatgcgggcgacgctgtcggaaaacgccgtctttacgaat
aacactctgaatcaggtgacagacggaatcagcatgtcggccggcaatatcaccgtaaaa
caaaatgtgctgacatcgttcagccggggcatatgggtcacaggcggaaatgccgttatt
gaaggaaatacgctgattccgaatgcgtatcagggcgccgcggagtcctatgccgtatct
gtgacaaatgacgccagggctgtcatcaaaggcaatctctttaagaactataaaaactat
cccgtattcagttcaacatcctcgggaacctctgtcatcagcaaccgctttgaatcatca
ccgcttatcgttaccgtgtatctgaactcaggcacgcatgaagtcatagacaatacgctt
acgatcaaccgaacggcgggcagcccgatcggcatctatctgaacggagcctccaattcc
ctcgtgtcgggcaataccatcaacaacctttccgccgcttctgcttccgccatccaaacc
aattcctccgcaagtactaaaattatcggcaaccgcattatcaaaggcgtcattgtgaaa
cacacgacagatacggaaagcggaaatatcgtcatctga

DBGET integrated database retrieval system