KEGG   Bacillus amyloliquefaciens Y2: MUS_0369Help
Entry
MUS_0369          CDS       T02108                                 

Gene name
yclO
Definition
(GenBank) iron complex transport system permease protein
  KO
K02015  iron complex transport system permease protein
Organism
bqy  Bacillus amyloliquefaciens Y2
Brite
KEGG Orthology (KO) [BR:bqy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bqy02000]
    MUS_0369 (yclO)
Transporters [BR:bqy02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter
    MUS_0369 (yclO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecCD ABC-3 7TMR-DISM_7TM DUF3180
Motif
Other DBs
NCBI-ProteinID: AFJ60451
UniProt: I2C1C7
LinkDB All DBs
Position
387239..388186
Genome map
AA seq 315 aa AA seqDB search
MSHNKKITLLAALAMICIGFFLFYGLGNWEYSLPRRCFKVLAMMLTGGAIAFSTVIFQTI
TNNRILTPGILGLDSLYMLIQTVIVFLFGSMNIVMMNKNLNFVISVGLMVLLSLVLYQLM
FKGEGRNVFFLLLVGVVFGTLFNSLSSFMQMLIDPNEFQVVQDKMFASFNNINTDLLWFA
GAVFLLTGIYVWRFTRFFDVLSLGREHAVNLGIDYDKLVKQMLIVVAILVSVSTALVGPI
MFLGLLVVNLAREFLKTYRHTYLIAGSVLISIVALVGGQFVVEKVFTFSTTLSVIINFAG
GIYFIYLLLKENKSW
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagtcataataaaaaaattacgctgctggcggcgctcgccatgatatgtatcggattc
ttcctgttctacggactgggcaattgggaatactccctgccgagacgatgcttcaaagtg
cttgccatgatgctcaccggaggagcgatcgcgttttcaacggtcatcttccagacgatt
acaaataaccgcatactgacaccgggcattttaggcctcgattccctgtatatgctcatt
cagaccgtcatcgtgttcctgttcggttcaatgaatatcgtcatgatgaacaaaaatctt
aatttcgtcatctccgtcggactgatggtgctcttgtcactcgttttgtatcagctcatg
tttaaaggcgaggggcggaacgtgtttttccttctgcttgtcggcgtcgtgttcggcacg
ctgttcaacagtctgtcatcctttatgcagatgctgattgatccgaatgagttccaggtt
gttcaggacaaaatgtttgccagctttaacaatatcaacaccgatcttttatggtttgcc
ggtgctgtctttcttctgacgggcatttatgtctggcggttcacgcggttttttgacgtg
ctgtcgctcggcagggagcacgccgtcaacctggggattgattacgataagcttgtgaaa
cagatgctcattgtcgtcgccattcttgtgtctgtctctacggctcttgtggggccgatt
atgtttttaggactgcttgtcgtcaatctggcgagagagtttttaaaaacctacaggcac
acgtatttaatcgcgggttctgtcctgatcagcatcgtcgcgctcgtcggaggccagttc
gtcgtggagaaagtgttcacgttttccacgacgctgagcgtcatcattaattttgccggc
gggatttattttatctatctgctgttaaaggagaataaatcatggtag

DBGET integrated database retrieval system