KEGG   Bacillus amyloliquefaciens Y2: MUS_0459Help
Entry
MUS_0459          CDS       T02108                                 

Gene name
ddl
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
bqy00473  D-Alanine metabolism
bqy00550  Peptidoglycan biosynthesis
bqy01100  Metabolic pathways
bqy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bqy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MUS_0459 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MUS_0459 (ddl)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    MUS_0459 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bqy01011]
    MUS_0459 (ddl)
Enzymes [BR:bqy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MUS_0459 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:bqy01011]
 Precursor biosynthesis
  Amino acid ligase
   MUS_0459 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST GARS_A ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AFJ60533
UniProt: I2C1K9
LinkDB All DBs
Position
462815..463879
Genome map
AA seq 354 aa AA seqDB search
MYGGKSAEHNVSLQTALAVTKALNTEKFDIHPIYITEKGEWQRGPLLTEPVSNVKMLQLE
QNGESFALSALNREMFPEASPDEKAPIDVVFPLLHGPNGEDGTIQGLLELLNVPYVGNGV
LASSAGMDKVIMKHLFAQAGLPQAKYAAFLKKDWKQTPDSCLQQVEEELGYPCFVKPANL
GSSVGISKCRNREELEKAFELAFEYDRKIVVEEGIAGREIEIGVLGNDEPKCSAVGEIAP
KTDFYDYKAKYEDGDTDLMIPAQVTDEQYAEISEMAIKAFKAIDGSGLVRADFFLTNDGQ
VLINEVNTMPGFTPFSMFPLLWKEAGVDYSDLIEQLVELAKERHAEKQLIKHTF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgtacggcggaaagtcagccgaacacaatgtatcgctgcagacagcattagctgtaaca
aaagcgcttaatactgagaagtttgatatacatccgatttacatcactgaaaaaggagaa
tggcaaagaggcccgctgctgactgagccggtttccaacgtgaaaatgcttcagctggaa
caaaacggtgaaagtttcgctctatcagcattgaaccgggaaatgtttcctgaagcgtcg
cctgacgaaaaggcgccgatcgatgtcgtatttccgcttctgcacggaccgaacggtgaa
gacggcaccattcagggtctgctggaattgctgaacgttccttatgtcggcaacggggtg
cttgcatcatcagccggcatggataaagtcatcatgaagcatttgttcgctcaagcgggg
cttccgcaggcgaagtacgccgctttcttaaaaaaggactggaaacagacgccggacagc
tgcttacagcaggttgaagaggagctgggatatccgtgcttcgtcaaaccggcgaacctc
gggtcaagcgtcggaatcagcaaatgccgaaatcgcgaagagcttgaaaaagccttcgaa
ctggcttttgagtatgaccggaaaattgtggtggaagaaggaatcgccggcagagaaatc
gaaatcggcgtactcggaaatgacgaaccgaaatgctccgccgtcggtgaaatcgcgccg
aaaaccgacttttacgattacaaggcgaaatatgaagacggcgacacggatttaatgatt
cccgcgcaagtgacggatgaacaatatgcggaaatcagcgagatggcgattaaagccttc
aaagcgattgacggatcaggccttgtccgcgccgatttcttcctgaccaatgacggtcaa
gtgctcattaacgaagtgaacacaatgccgggctttacgccattcagcatgttcccgctg
ctttggaaagaagcaggcgtagattacagtgatctgatcgaacagctggttgagctggca
aaagaacgccatgccgaaaaacagctgattaaacatacattttaa

DBGET integrated database retrieval system