KEGG   Bacillus amyloliquefaciens Y2: MUS_0468Help
Entry
MUS_0468          CDS       T02108                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
bqy00473  D-Alanine metabolism
bqy01100  Metabolic pathways
bqy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bqy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MUS_0468 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    MUS_0468 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bqy01011]
    MUS_0468 (alr)
Enzymes [BR:bqy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     MUS_0468 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bqy01011]
 Precursor biosynthesis
  Racemase
   MUS_0468 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Big_11
Motif
Other DBs
NCBI-ProteinID: AFJ60542
UniProt: I2C1L8
LinkDB All DBs
Position
471537..472706
Genome map
AA seq 389 aa AA seqDB search
MNTASFYRETWAEINLSAIKENVTHMKKHIGQNVHLMAVVKANAYGHGDLEVGKAALEAG
ASCLAVAILDEAISLRKQGITAPILVLGAVPPEYVQAAAEYDVTLTGYSVEWLQEAARHL
GSATVPFHLKVDTGMNRLGVKTEEEIQSVLKILGQNPGLVCKGVFTHFATADEKNRDYFL
FQFDRFKELIAPLPLKELMVHCANSAAGLRLKKGFFNAVRFGISMYGLRPSADIQSEIPF
QLKPAFALHSVLSHVKKIRKGESVSYGATYTAEKDQWIGTVPIGYADGWLRKLSGTSVLI
GGKRMNIAGRICMDQLMVELDQSYPPGTKVTLIGSQKEATITMDEIAGRLGTINYEVPCT
ISSRVPRMFLENESIMEVRNPLLQDNTSK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacacagcatccttttacagagaaacgtgggcggaaatcaacctgtccgcgattaaa
gaaaatgtcacgcatatgaaaaaacacatcgggcaaaacgtccatctcatggcggttgta
aaggcgaacgcttatggccacggagatttggaagttgggaaagccgcgcttgaagcgggt
gcctcttgtcttgccgtagccatactggatgaagcgatttcattgagaaagcagggcatt
acggcgccgattctcgtgcttggcgccgtgccgcccgaatatgtacaagcagctgccgag
tatgacgtaacactcacgggatattctgttgaatggcttcaggaagccgcgcgccacctc
ggaagtgcaacagtgccgttccacctgaaagtcgacaccggcatgaacagactcggagtc
aaaacggaggaagaaatccaaagcgtgttaaaaatcctcggtcaaaatcccggtttagtc
tgtaaaggcgtattcacccattttgctaccgcggatgagaaaaacagagattatttcctc
ttccagtttgaccgctttaaagaattgatcgctccgcttcctttaaaagaattgatggtg
cactgcgcgaacagcgctgccggacttcgtcttaaaaaaggcttttttaacgcggttcgt
ttcggcatcagtatgtacgggctccgtccttctgctgacatccaaagcgaaattcctttt
caattgaagccggcttttgcgctgcactctgttttatcccatgtgaaaaagatccgcaaa
ggggaaagcgtcagctacggcgcaacatatacggcagagaaggatcaatggatcggaacg
gttcccatcggctatgcagacgggtggctccgcaagctgagcggcacgtctgtgctgatc
ggcggcaaacggatgaacatcgcgggaagaatctgcatggatcaattgatggtcgaatta
gatcaatcttatccgccgggcaccaaagtcaccctgatcggcagccagaaggaagcaacg
atcacgatggatgaaatcgcagggcggcttgggacgattaattacgaggtcccttgtacc
attagttcccgcgttccccgtatgtttttggaaaatgagagtataatggaagtaagaaat
cctttactgcaagataatacaagcaagtag

DBGET integrated database retrieval system