KEGG   Bacillus amyloliquefaciens Y2: MUS_0631Help
Entry
MUS_0631          CDS       T02108                                 

Gene name
ydjL
Definition
(GenBank) zinc (Zn) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
bqy00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bqy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MUS_0631 (ydjL)
Enzymes [BR:bqy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     MUS_0631 (ydjL)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     MUS_0631 (ydjL)
    1.1.1.-  
     MUS_0631 (ydjL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N 2-Hacid_dh_C PALP F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AFJ60700
UniProt: I2C226
LinkDB All DBs
Position
complement(615060..616100)
Genome map
AA seq 346 aa AA seqDB search
MKAARWHNQKDIRIENIDEPKAEPGKVKIKVKWCGICGSDLHEYLGGPIFIPVGKPHPLT
NEMAPVTMGHEFSGEVVEVGEGVKNYSVGDRVVVEPIFATHGHQGAYNLDEQMGFLGLAG
GGGGFSEYVSVDEELLFKLPEELSYEQGALVEPSAVALYAVRQSKLKAGDKAAVFGCGPI
GLLVIEALKAAGATDIYAVELSPERQEKAKELGAIIIDPSKTDDVVEEIAKRTNGGVDVS
YEVTGVPVVLRQAIQSTNIAGETVIVSIWEKGAEIHPNDIVIKERTVKGIIGYRDIFPSV
LALMKEGYFSADKLVTKKIVLDDLIEEGFGALIKEKNQVKILVKPN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggcaagatggcacaatcaaaaagacattcgaatcgaaaacattgatgaacct
aaagcagaaccgggtaaagtcaaaattaaagtcaaatggtgcgggatttgcggaagcgac
cttcatgaatatttgggaggcccgatctttattccggtcggcaaacctcatccgttaaca
aacgaaatggcgcccgtcacgatgggtcacgaattctcaggagaagtcgttgaagtgggc
gaaggcgtcaaaaattacagcgtcggcgaccgtgtcgtcgtggaaccgatttttgccaca
cacggacatcagggagcctataaccttgatgaacaaatgggattcttaggcttagccgga
ggcggcggcggattttctgaatatgtatccgttgacgaagaattgctgtttaagcttcct
gaagagctttcttacgaacagggcgcgcttgttgagccgtcagcggtagcgctttacgcc
gtccgccaaagcaaattaaaagcgggcgacaaggcggcagtttttggctgcggaccgatc
gggctgcttgtgattgaagccctgaaagcggccggcgccacagatatttacgcggttgaa
ctttcaccggaacgtcaggaaaaagcgaaagaactcggcgctatcatcattgatccgtca
aaaacggacgatgtcgttgaagaaatcgctaaacgcacaaacggcggcgttgatgtttct
tatgaagtaacaggcgttcctgtcgttctccgccaggcaatccagtcaacaaacattgcc
ggtgaaacggttatcgtcagcatctgggaaaaaggagcggaaattcatccgaacgatatc
gtcatcaaagaacggaccgtaaaaggcattatcggataccgtgacatcttcccttccgtt
cttgcactgatgaaagagggctacttctcagcagataagctcgtcacgaaaaaaatcgtg
ctcgacgatctgattgaagaaggctttggcgctttaatcaaagagaaaaaccaagtgaaa
atcttagtcaaaccgaactaa

DBGET integrated database retrieval system