KEGG   Bacillus amyloliquefaciens Y2: MUS_0647Help
Entry
MUS_0647          CDS       T02108                                 

Definition
(GenBank) putative phosphoenolpyruvate phosphomutase (phosphoenolpyruvate mutase) (PEP mutase) (PEP phosphomutase)
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
bqy00440  Phosphonate and phosphinate metabolism
bqy01100  Metabolic pathways
bqy01120  Microbial metabolism in diverse environments
bqy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bqy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    MUS_0647
Enzymes [BR:bqy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     MUS_0647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase ICL DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AFJ60716
UniProt: I2C242
LinkDB All DBs
Position
631959..632849
Genome map
AA seq 296 aa AA seqDB search
MMVKNRKSSIFRDALNSKGLVKVAGAHDGLSAKLAEKNGFNAVWASGLGISAVQTVPDAS
ILTMTEFLEAAVIMNESCNLPVIADCDSGYGNIHNVTRMIKKYEAAGIAGVCIEDKVYPK
LNSFDDRQQILVSTEEFCAKIRAAKMAQQNDDFVLIARVEALIAKLGQEEAYTRAKAYVH
AGADAILIHSKEQSPDEIIEFVNNWDVDAPLVVVPTKYPTLSMEQLEKLGVKVSIYANQA
LRASVKAINDTFESIINNKSSLQIENDIVSVNEIFDIQDVPGMKQLERLIHRQPAN
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgatggtgaaaaacagaaaatcatcaatttttagagatgctttaaacagtaaaggtttg
gtgaaagttgcgggagctcatgacggtttaagcgccaaattagcagagaaaaacggattt
aatgccgtatgggcaagcggtttgggaatctcggctgtgcaaactgtacctgatgccagt
atattaacgatgactgaatttcttgaagccgccgtcattatgaatgaatcatgcaatttg
ccggtcatcgctgactgtgattccggctacgggaacattcacaatgtcacccgcatgatc
aaaaaatacgaagctgctggtattgccggagtttgtattgaagataaagtatatccaaaa
ttaaactcatttgacgacagacaacagatccttgtcagtactgaagaattttgcgcaaaa
attagagccgcaaagatggctcagcaaaatgacgattttgtattgattgcccgtgtcgaa
gctttaattgctaaattgggtcaagaagaagcctatacaagagcaaaagcttatgttcat
gctggagcagatgcaattttaattcattcaaaagaacaatcgcctgatgaaattattgag
tttgttaacaattgggacgtggatgcgccgttggttgtggttccgactaaatatccgacg
ctctcaatggaacagcttgagaaattgggagtgaaggtttccatctatgcgaatcaggcg
ttgcgcgcttctgttaaggctataaatgatacattcgaaagcattataaataataaatcg
tctttgcagattgaaaatgacatcgtgagcgttaatgagatatttgacattcaagacgtt
ccggggatgaagcaactggagcgtttgatccatagacagccggctaactga

DBGET integrated database retrieval system