KEGG   Bacillus amyloliquefaciens Y2: MUS_0743Help
Entry
MUS_0743          CDS       T02108                                 

Gene name
yfmT
Definition
(GenBank) aldehyde dehydrogenase (NAD+)
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
bqy00627  Aminobenzoate degradation
bqy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bqy00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    MUS_0743 (yfmT)
Enzymes [BR:bqy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     MUS_0743 (yfmT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFJ60804
UniProt: I2C2D0
LinkDB All DBs
Position
720088..721545
Genome map
AA seq 485 aa AA seqDB search
MFQYEELNKQFIGGRWRDGSSRNVLENRNPYTQKVITSFQKATSDDVDAAYRAAALAKQE
WDKVNPFKKRAILEKAVSFIEEHEEAIIYLIMEELGGTRLKAEFEIGLVKNMIKEAATFP
VRMEGKILPSTIAGKENRLYRIPAGVVGVISPFNFPFFLSMKSVAPALGAGNGVVLKPHE
ETPICGGTLIAKIFEAAGVPDGLLNVIVTDIGEIGDSFVEHPVPRIISFTGSTGVGSYIG
QLAVKHFKKPLLELGGNSALIVLEDADLEYAVNAAVFSRFTHQGQICMSANRVLVHTSVY
DKFTELYEAKVSSLKVGDPMDPDTVIGPLINERQAEGLRRSVEKAIEEGAVPVLSGRFSG
TVAEPVILKDVKPEMSIAKEELFGPAVCIMPFETEDEAVSIANATPFGLSGAVHTANVER
GVEFAKRIETGMIHVNDTTINDEPNVAFGGEKQSGLGRLNGEWSLEEFTTLKWISVQHEK
RQFPY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaatatgaagaactaaataagcagtttatcggcggccgatggagggatgggagc
agccggaacgtattggaaaacagaaatccttatactcaaaaagtcatcacctcattccaa
aaagcgacgtctgatgacgtggatgcggcatatcgcgccgcggctcttgcgaaacaagaa
tgggacaaagtaaacccttttaaaaagcgggccattttggaaaaagccgtttctttcatc
gaagagcacgaagaagcgattatttacttaatcatggaggagcttggcggaacacggctg
aaggctgagtttgaaatcggacttgtcaaaaatatgataaaagaagccgcaacatttccg
gtgcggatggaagggaaaattctcccgtccacgattgccggaaaagaaaacaggctgtac
agaatacccgccggagtcgtgggggtgatcagcccgtttaatttcccgtttttcctttcg
atgaaatctgttgcgccggcactcggcgcggggaacggcgtcgtgctgaagcctcatgaa
gaaacaccgatctgcggcggaacgcttatcgcgaaaatttttgaagcggccggcgtaccg
gacgggctgctgaatgttatcgtgacggatatcggggagatcggcgacagctttgttgag
catcccgtgccgcggattatctcatttacaggctcaaccggagtgggcagctatatcgga
cagcttgcggtcaaacactttaaaaaaccgctgttggagcttggcggaaacagcgcgctg
atcgtgcttgaggatgctgatcttgaatacgccgtcaatgcggccgtattcagccggttt
acgcatcaaggccagatctgtatgtcggcgaaccgcgtgctcgttcacacatctgtatat
gacaaatttacagagctttacgaagcgaaagtgtcatcgctgaaagtcggcgatccgatg
gaccctgatacggttatcggtcctttaatcaatgagagacaggcggaaggtctgagacgg
tctgtcgaaaaagcgatagaagagggagcggttccggtgctgtccggccgattcagcgga
acggtcgctgagcccgtcattttaaaagatgtaaaacctgagatgagcattgcgaaggag
gagctgttcggaccggccgtctgcatcatgccgtttgaaacggaggatgaagcggtaagc
atcgcaaacgcgacaccgttcggtttaagtggagccgtgcatacagcaaacgttgagcgc
ggcgttgagtttgctaagcggatcgaaaccggcatgattcacgtcaacgatacgaccatt
aatgatgaaccgaacgtcgcgttcggcggcgagaagcaatcaggtctcggcaggctgaac
ggcgaatggagccttgaagaattcaccacgctgaaatggatttcggttcagcatgaaaaa
cggcaattcccatattaa

DBGET integrated database retrieval system