KEGG   Bacillus velezensis YAU B9601-Y2: MUS_2040
Entry
MUS_2040          CDS       T02108                                 
Name
(GenBank) hypothetical protein,prophage-derived uncharacterized protein, phage SPbeta
Organism
bqy  Bacillus velezensis YAU B9601-Y2
SSDB
Motif
Pfam: DUF4371 DUF982
Other DBs
NCBI-ProteinID: AFJ62005
UniProt: I2C5T1
LinkDB
Position
1975998..1976141
AA seq 47 aa
MQQYTVMKVEENAVCVYRWIDDYRHKIERFTDVEEAKKLLGEGWPKQ
NT seq 144 nt   +upstreamnt  +downstreamnt
atgcagcagtacaccgtcatgaaagttgaagaaaatgcagtatgtgtttaccggtggatc
gatgattatagacacaagattgaaagattcacagatgttgaagaggctaaaaaactcctt
ggagaagggtggccgaaacaataa

DBGET integrated database retrieval system