KEGG   Bacillus amyloliquefaciens Y2: MUS_2798Help
Entry
MUS_2798          CDS       T02108                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase, Fe-Mn family
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bqy  Bacillus amyloliquefaciens Y2
Brite
Enzymes [BR:bqy01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MUS_2798 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AFJ62706
UniProt: I2C7T2
LinkDB All DBs
Position
complement(2690436..2691041)
Genome map
AA seq 201 aa AA seqDB search
MAYKLPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAIEGSALAEKSVDELVADL
NAVPEDIRTAVRNNGGGHANHSLFWTLLSPNGGGEPTGELAEEIKSTFGSFDQFKEKFAA
AAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPVLGLDVWEHAYYLNYQNRRPDY
ISAFWNVVNWDEVARLYSEAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcttacaaacttccagaattgccttacgcttatgatgctttagaacctcatatcgat
aaggaaacgatgacgattcaccatacgaagcaccataacacatacgtgacaaacctcaac
aaagcgatcgaaggatcagcgcttgcagagaaatctgtagatgagcttgttgctgatttg
aacgcagtgccggaggacatccgcacggcagtccgcaacaatggcggcggacatgcaaac
cactctttattctggactcttttatctccgaacggcggaggcgaaccgactggtgagctt
gctgaagagatcaaaagcacgttcggaagcttcgatcaatttaaagaaaaattcgccgca
gcagctgcaggccgtttcggttcaggctgggcttggctcgttgtaaataacggaaaactt
gaaattacaagcacgccaaaccaagattcaccgctttcagagggtaaaacacctgttctc
ggtcttgatgtttgggagcatgcgtactacctgaactaccaaaaccgccgtcctgattac
atttcagctttctggaatgttgtgaactgggatgaagttgcccgtctttacagcgaagca
aaataa

DBGET integrated database retrieval system