KEGG   Bacillus amyloliquefaciens Y2: MUS_3199Help
Entry
MUS_3199          CDS       T02108                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bqy  Bacillus amyloliquefaciens Y2
Pathway
bqy00010  Glycolysis / Gluconeogenesis
bqy00030  Pentose phosphate pathway
bqy00051  Fructose and mannose metabolism
bqy00052  Galactose metabolism
bqy00680  Methane metabolism
bqy01100  Metabolic pathways
bqy01110  Biosynthesis of secondary metabolites
bqy01120  Microbial metabolism in diverse environments
bqy01130  Biosynthesis of antibiotics
bqy01200  Carbon metabolism
bqy01230  Biosynthesis of amino acids
bqy03018  RNA degradation
Module
bqy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bqy_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bqy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MUS_3199 (pfkA)
   00030 Pentose phosphate pathway
    MUS_3199 (pfkA)
   00051 Fructose and mannose metabolism
    MUS_3199 (pfkA)
   00052 Galactose metabolism
    MUS_3199 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    MUS_3199 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    MUS_3199 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:bqy01009]
    MUS_3199 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:bqy03019]
    MUS_3199 (pfkA)
Enzymes [BR:bqy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MUS_3199 (pfkA)
Protein phosphatases and associated proteins [BR:bqy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MUS_3199 (pfkA)
Messenger RNA biogenesis [BR:bqy03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MUS_3199 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AFJ63084
UniProt: I2C8W0
LinkDB All DBs
Position
complement(3042456..3043415)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYSGLISGKIEKLELGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIENLKKLGIEGLVVIGGDGSYMGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMQEIIGRLKRGHDRGKKHSIIIVAEGVGSGVEFGKRIEEETNL
ETRVSVLGHIQRGGSPSASDRVLASRLGAYAVELLLKGKGGRCVGIQNNKLVDHDIIEIL
ESKHTVEPNMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtataggagttttaacgagcggcggggattccccgggtatgaacgctgcggtg
cgcgcggttgtgcggaaagctatctaccacgacgtcgaagtgtacggaatttataacggt
tattcaggattaatcagcggaaaaatagagaaactggagcttggttcggtcggtgacatc
atccaccgcggcggaacaaagctgtacacggccagatgtcctgaattcaaaacagttgaa
ggccgtgaaaaaggaatcgaaaatttaaagaaactcggcattgaaggtcttgtcgtcatc
ggcggagacggttcatacatgggtgcgaaaaaattaacggaacacgggtttccgtgtgtg
ggtgtaccgggtacgatagataatgacatcccgggaactgattttacgatcggatttgat
acggcgctaaataccgtaattgatgcgattgataaaatccgtgacaccgctacgtctcat
gagcgtacatacgttattgaagtgatggggcgccatgcgggcgacattgctttatgggca
ggtcttgcaggcggagcggaatcaattttaattcctgaagcggactacgatatgcaggaa
attatcggccgtttgaagagagggcacgaccgcggcaaaaaacacagtatcatcatcgtt
gcagaaggggtaggcagcggggttgaattcggaaaacgcatcgaagaagaaacgaacctt
gaaacacgggtatccgttttagggcacatccagcgcggcggatctccaagcgcttctgac
cgggttcttgcaagccgcctcggcgcttacgcggttgagcttctgcttaaaggaaaaggc
ggacgctgcgtaggtatacaaaacaacaagcttgtagaccatgatattatagaaatttta
gaatcaaaacatactgttgaaccaaacatgtatcagctttcaaaagaactgtctatttaa

DBGET integrated database retrieval system