KEGG   Bacillus amyloliquefaciens Y2: MUS_3593Help
Entry
MUS_3593          CDS       T02108                                 

Gene name
yusP
Definition
(GenBank) MFS transporter, DHA2 family, multidrug resistance protein B
Organism
bqy  Bacillus amyloliquefaciens Y2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 TRI12 Sugar_tr MFS_3 OATP MFS_2 MFS_1_like
Motif
Other DBs
NCBI-ProteinID: AFJ63463
UniProt: I2C9Y9
LinkDB All DBs
Position
3396045..3397640
Genome map
AA seq 531 aa AA seqDB search
MSIEKKDPKRTLLITGLIIAMFFSALDGTIVGTAIPKIVGDLGGLSMMTWLTTAYLLTST
TIVPIAGKLADLLGRRVVYVSGLLIFMGASALCGMASNMTELIIFRGLQGIGGGVMMPMA
MIVIGDLFTGKQRAKFQGLFGAIYGLASVIGPQIGGWIVDSLNWKWVFYINLPVGILAVI
FIARGLQGRKQTGPINFDIAGIFTMIVGIVSLLLALSFGGKDYAWGSWQILGLFALALAG
IVGFIFAEIKAKEPILPMYLFKNRTFTVLNLIGFFMSIGMFGAVTFVPFFMQGIIGVSAT
ASGTIMTPMMVSMIITSIIGGQLVYKIGIKPQIMIGMLIMAVGFFLLTTLQLDTSKLAAT
CYMAVIGLGMGLVMPLLTLALQETFSKEELGVVTSSSQFFRMIGGTFGITVLGAVMNARS
GSLLTDRLVPYLDSLPKQASAFAAQFKGMIDKNPEGLLQSLFSQESIKQIPAAFSSHIVP
VLKTSLMDSLHSVFFTGLAFIAAGLILTLFVKSIKLTNKKTGKQEEKAKAV
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgagcattgaaaagaaagatccaaaacgcacattattgataaccggcttaatcatcgcc
atgtttttctcagcccttgacggcaccatcgtaggaacggcgattcctaaaatcgtgggt
gacctcgggggattaagcatgatgacgtggctgaccacggcatatcttttaacttcgacg
acgatcgttccgattgcggggaaacttgcagatttattgggacgccgcgtcgtctatgtg
tcaggtttattgatttttatgggagcttccgcactgtgcggaatggccagcaacatgacg
gaactgattattttccgcggacttcagggaatcggcggcggtgtcatgatgccgatggct
atgatcgtcatcggggatttgttcacaggaaaacagcgtgccaagttccaagggcttttc
ggggcgatttacgggcttgcttccgtgatcggcccgcaaatcgggggctggattgttgac
tcattaaattggaaatgggttttctatatcaacctgcctgtcggaattttagccgtgatc
tttatcgcaagaggacttcaaggcagaaaacagactgggccgattaactttgacatcgcc
ggcattttcacaatgatcgtcggaatcgtcagcctcctcctcgcgctcagcttcggagga
aaggattacgcatggggctcttggcagattctcggtctctttgcgcttgcgcttgccggg
attgtcggattcattttcgctgaaatcaaagcaaaggagccgattctgccgatgtacctg
tttaaaaacagaacgtttaccgtactgaatctgatcggctttttcatgagtatcggcatg
ttcggcgccgttacgttcgttcctttctttatgcagggaattatcggagtcagcgccacc
gcgtccggaacgattatgacgccgatgatggtatctatgattatcacaagtattatcgga
ggccagctggtttataagatcggtattaaaccgcaaatcatgatcggcatgctgatcatg
gccgtcggcttcttcttattaacgacattgcagctggatacaagcaagctcgcggcgacg
tgctatatggccgtgatcggtctgggaatggggctcgtcatgccgcttctcacactcgct
ctgcaagaaacgttttcaaaagaagagctgggtgttgtgacctcttcaagccaatttttc
cggatgatcgggggaacgttcggcattacggtgctcggcgctgtcatgaatgccagatca
ggaagccttttaaccgacagactggtgccttacttagactcactgccgaaacaggcaagt
gcctttgccgcccagtttaaaggtatgattgacaagaatcctgaagggctgcttcaatcc
ctgttcagccaggaatcgattaagcagattccggccgcattttcttcccatatcgtgccg
gttttgaaaacgtcactgatggattcgcttcacagcgtgtttttcacaggcctggccttt
atcgctgccggattgatcctcacgctgtttgttaaatcaattaaactgacaaacaaaaag
acaggcaaacaagaagaaaaggcgaaagccgtttaa

DBGET integrated database retrieval system