KEGG   Bacillus amyloliquefaciens Y2: MUS_4389Help
Entry
MUS_4389          CDS       T02108                                 

Gene name
ahpF
Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bqy  Bacillus amyloliquefaciens Y2
Brite
KEGG Orthology (KO) [BR:bqy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MUS_4389 (ahpF)
Enzymes [BR:bqy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     MUS_4389 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA FAD_oxidored HI0933_like Thi4 DAO AlaDh_PNT_C Glutaredoxin NAD_binding_7 FAD_binding_3 NAD_binding_8 K_oxygenase Thioredoxin_4 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AFJ64222
UniProt: I2CC48
LinkDB All DBs
Position
4124437..4125966
Genome map
AA seq 509 aa AA seqDB search
MVLDANIKAQLNQYMQLIENDIVLKVSAGDDDTSKDMLALVDELASMSSKISVEKTELNR
TPSFSVNRTGEDTGVTFAGVPLGHEFTSLVLALLQVSGRAPKADQKVIDQIKNISGEYRF
ESYISLTCHNCPDVVQALNMMSVLNPNITHTMIDGAAFKEEVESKNIMAVPTVFLNGESF
GSGRMTIEEILAKMGSGADASEFADKEPFDVLVVGGGPAGASAAIYTARKGIRTGVVAER
FGGQVLDTMSIENFISVKATEGPKLAASLEEHVKDYDIDVMNLQRAKRLEKKDLFELELE
NGAVLKSKTVILSTGARWRNVNVPGEQEFKNKGVAYCPHCDGPLFEGKDVAVIGGGNSGI
EAAIDLAGIVNHVTVLEFAPELKADEVLQKRLYSLPNVTVHKNAQTKEITGDQNVNGITF
VDRETGEEKHVELQGVFVQIGLVPNTEWLDETVERNRIGEIIVDKSGATSVPGLFAAGDC
TDGPYNQIIISMGSGATAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ttggtacttgacgcaaatatcaaagcacaattaaatcaatacatgcagctaattgagaac
gacattgttctcaaagtaagcgccggtgacgatgacacttctaaggacatgctggctctc
gttgacgagctggcttccatgtcatctaaaatttcagttgaaaaaactgaattaaacaga
acaccgagtttcagcgttaatcgtaccggagaagacacaggcgttacattcgccggtgtt
cctctcggccacgaatttacatcattagtgctggcattgcttcaagtcagcggcagagcg
cctaaggctgatcaaaaggtcattgaccagattaagaacatcagcggagaataccgcttt
gagtcttatatcagcctgacgtgccacaactgccctgatgtcgtccaagcattaaacatg
atgagcgtgctcaacccgaatatcacacatacaatgattgacggcgcggcattcaaagaa
gaagtagaaagcaaaaacattatggctgttccgactgttttcttaaacggtgaatctttc
ggaagcggccgtatgaccatcgaagagattctcgcgaaaatgggcagcggcgcagatgcg
tctgagtttgccgacaaagagccatttgacgttcttgttgtcggcggcggacctgccggc
gcaagcgcggcgatctacacggcgcgtaaaggcatccgcaccggtgtcgtcgctgaacgc
ttcggcggccaggtactcgacaccatgagcatcgagaacttcatcagcgtcaaagcgact
gaaggaccgaagctcgccgcaagccttgaagagcacgtgaaagattatgatattgacgtc
atgaaccttcagcgtgcgaaacgccttgagaaaaaagacctcttcgaacttgaacttgaa
aacggcgctgtactgaaaagtaaaacagtgatcctttcaacaggtgcccgctggcgcaat
gtcaacgtacctggtgagcaagagttcaaaaacaaaggtgttgcatactgcccgcactgt
gacggaccattgtttgaaggcaaagacgtagcggttatcggcggcggaaactccggaatc
gaagcggcgattgaccttgcaggtatcgtcaatcacgtgactgtgctggaattcgcgcct
gaactgaaagcagacgaagtcctgcaaaaacgtctttacagcctgccaaacgtcactgtg
cacaaaaatgcacaaacgaaagaaatcactggcgatcaaaacgtaaacggcattacgttc
gttgaccgtgaaacaggcgaagaaaaacacgttgaacttcaaggtgtattcgtccaaatc
ggtctcgtgcctaatacagaatggttagacgaaactgtcgaacgcaaccgcatcggcgaa
atcatcgtcgataagagcggcgcgacaagcgttcccggcctatttgccgcaggggactgc
acagacggcccgtacaaccaaatcattatctccatgggatcaggtgcaactgccgcttta
ggcgcatttgattatttgatccggaattaa

DBGET integrated database retrieval system