KEGG   Bradyrhizobium sp. ORS 278: BRADO0609Help
Entry
BRADO0609         CDS       T00516                                 

Definition
(GenBank) bifunctional: shikimate kinase (N-terminal); dehydroquinate synthase (C-terminal)
  KO
K13829  shikimate kinase / 3-dehydroquinate synthase [EC:2.7.1.71 4.2.3.4]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bra01100  Metabolic pathways
bra01110  Biosynthesis of secondary metabolites
bra01130  Biosynthesis of antibiotics
bra01230  Biosynthesis of amino acids
Module
bra_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bra00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BRADO0609
Enzymes [BR:bra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     BRADO0609
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     BRADO0609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase SKI Fe-ADH_2 Fe-ADH AAA_33 AAA_18 Cytidylate_kin2 AlaDh_PNT_C CoaE AAA_16 AAA_22 AAA_17 AAA Mg_chelatase ParA RsgA_GTPase AAA_5
Motif
Other DBs
NCBI-ProteinID: CAL74545
RhizoBase: BRADO0609
UniProt: A4YKW9
LinkDB All DBs
Position
633392..635194
Genome map
AA seq 600 aa AA seqDB search
MTELTQPASGPGAPEAAILAGLGKRLIVLVGMMGVGKSTVGRRLAARLRLPFVDADTEIE
TAAGMSIPEIFESRGEDYFRNGEARVIARLLESGPAVLATGGGAFMREETRRRIHEKAVS
VWLKADAEVIMRRVRRRADRPLLQTADPEGTVTRLLSEREPVYGLADLKICSRDVPHDRV
VEDCLQELQTFLSPAMAAAPAAEPQPHSLSSDSVQGVSMTAPLKSSDPIIVDVALGERAY
DIVIGRGVLDTLGRRIAALRPGVRTAIVTDRTVAAHWLKPTEAILAEAGIPSSTIVVEEG
EGSKTYAGLEKVSEALISAKIERNDLVIALGGGVVGDLAGFAASILRRGVDFVQVPTSLL
AQVDSSVGGKTGINSPQGKNLLGAFHQPVLVIADTAVLDTLSPRQFRAGYAEVAKYGLLG
DAGFFAWLEANQAEIVTGGAAREHAVATSCRAKAAIVARDERETGDRALLNLGHTFGHAL
EAITGFSDRLFHGEGVSVGMVLAAQFSAELGMLPPGDVTRIERHLAAVGLPTHLQDIAGF
AQEGIGDAERLLALMAQDKKVKRGKLTFILMEAIGRAVIANDVDPARVRDFLQAKLDRSG
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaactgacgcaacccgcatccggcccaggcgctccggaggccgcgatcctcgcg
ggcctcggcaagcggctgatcgtgctggtcggcatgatgggcgtcggcaagtcgacggtc
ggccggcggctcgcggcgcggctgcggctgcccttcgtcgacgcggacaccgagatcgag
accgcggccggcatgagcataccggagatcttcgaatcgcgcggcgaagactatttccgc
aacggcgaggcacgggtgatcgcccgcctgctcgaaagcgggccggcggtgctggccacc
ggcggcggcgccttcatgcgcgaggagacccgccgccgcatccacgagaaggcggtctcg
gtgtggctgaaggccgatgccgaggtgatcatgcgccgcgtccggcgccgcgccgaccgg
ccgctgctgcagactgccgaccccgaaggcacggtgacgcggctcctgagcgagcgcgag
ccggtctacgggctcgccgatctcaagatctgctcgcgcgacgtgccgcatgacagggtc
gtggaggactgcctgcaggagctgcagacgttcctgtccccggccatggccgcggctccg
gcggcggagccgcagccccattccctctcctccgattccgtacagggcgtttcgatgacg
gcaccattgaagtcttccgatccgatcatcgtcgacgtcgcgctcggcgagcgcgcctat
gacatcgtcatcggccgcggcgtgctggacacgctgggccggcgcatcgcagcgctgcgg
ccgggcgtgcgcaccgccatcgtcaccgaccgcaccgtcgctgcgcattggctcaagccg
accgaggcgattctggcggaggcggggatcccgtcatccaccatcgtggttgaggagggg
gagggctccaagacctatgccggcctcgaaaaggtcagcgaggcgcttatctcggcaaag
atcgagcgcaacgatctcgtcatcgcgctcggcggcggcgtggtcggcgatctcgccggc
tttgcggcttcgatcctgcgccgcggcgtcgatttcgtgcaggtgccgacctcgctgctg
gcgcaggtcgattcctccgtcggcggcaaaacggggatcaactcgccgcagggcaagaac
ctgctcggcgccttccaccagccggtgctggtgatcgccgacaccgcggtgctcgacacc
ttgtcgccgcgccagttccgcgccggctatgccgaggtcgccaaatacggcctgctcggc
gacgccggcttcttcgcctggctcgaggccaaccaagccgagatcgtcacgggcggcgcc
gcgcgcgagcatgcggtcgcgacctcctgccgcgccaaggccgcgatcgtcgcccgcgac
gagcgcgagaccggcgaccgcgcgctgctcaatctcggccacaccttcgggcatgcgctc
gaggccatcaccggcttctccgaccggctgttccatggcgagggcgtctcggtcggcatg
gtgctggcggcgcagttttcggctgagctcggcatgctgccgcccggcgacgtcaccagg
atcgagcgtcaccttgccgcagtgggcctgccgacccatctgcaggacatcgccggcttc
gcccaggaagggatcggcgacgccgaacggcttttggccttgatggcgcaggacaagaag
gtcaagcgcggcaagctcaccttcatcctgatggaagcgatcggccgcgcggtcattgcg
aatgacgtcgacccggcaagggtccgtgacttcctgcaggccaaattggacagaagcggc
tga

DBGET integrated database retrieval system