KEGG   Bradyrhizobium sp. ORS 278: BRADO1126Help
Entry
BRADO1126         CDS       T00516                                 

Gene name
cbbT
Definition
(GenBank) Transketolase (TK)
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00030  Pentose phosphate pathway
bra00710  Carbon fixation in photosynthetic organisms
bra01100  Metabolic pathways
bra01110  Biosynthesis of secondary metabolites
bra01120  Microbial metabolism in diverse environments
bra01130  Biosynthesis of antibiotics
bra01200  Carbon metabolism
bra01230  Biosynthesis of amino acids
Module
bra_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
bra_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bra_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bra_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:bra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BRADO1126 (cbbT)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BRADO1126 (cbbT)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    BRADO1126 (cbbT)
Enzymes [BR:bra01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     BRADO1126 (cbbT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N TPP_enzyme_C E1_dh
Motif
Other DBs
NCBI-ProteinID: CAL75037
RhizoBase: BRADO1126
UniProt: A4YMB1
LinkDB All DBs
Position
complement(1202019..1204004)
Genome map
AA seq 661 aa AA seqDB search
MTQVDHSRMANAIRALAMDAVEKAKSGHPGLPMGAADVATVLFTRVLKYDAAVPAWPDRD
RFVLSAGHGSMLLYALLYLTGNEEMTLDQIKRFRQVDSLTPGHPENFRTKGIETTTGPLG
QGISTAVGMALAEKMLQAEYGKKIVDHHTYVLASDGDLMEGISQEAIAMAGHWKLNKLIV
LWDDNGISIDGPLSIADSVDQVKRFKACGWAAELIDGHDPEAIAAAIARAQKSSRPSLIA
CKTTIGYGAPTKAGTSKVHGEALGAEELKGAKEKLGISQEPFSVPDDVLAAWREAGRRGA
PARAEWETRLGEMGPRKRAEFERRLRHERPAALAKALKDHKKALLENPLNIATRKSSEAA
IEVIAAAMPFEFVAGSADLTGSNNNKAKSATSFSAKTPKGRFIHYGIREHGMAAAMNGIF
LHGGFAPNGATFLVFSDYARGAMRLSALMGAGVVYVMTHDSIGLGEDGPTHQPVEHLAAL
RAIPNMRVFRPADAVETAECWELALNRTNGPTVLALTRQNLPQLRTSAPADNPCSHGGYE
LVAAQGDAKVSLFATGSEVEIAVAAQKQLAERGIPARVVSVPSLELLLEQPAEAKAKIIG
HAPVKIAIEAAVRWGWDAVIGTDGIFIGMHSFGESGPYKELYKHFGITAEAAVEAAVKRL
G
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggtcgatcattcccgcatggccaacgccatccgcgcgctcgcaatggacgcc
gtcgaaaaggcgaaatccggccatccgggcctgccgatgggcgccgccgacgtcgccacc
gtgctgttcacccgcgtgctgaaatatgatgcggccgtgcccgcctggcccgaccgcgac
cgcttcgtgctgtccgccggccacggctcgatgctgctctacgcgctgctgtatctgacc
ggcaacgaggagatgacgctcgaccagatcaagcgcttccgccaggtcgattcgctgacc
cccggccatccggagaatttccgcaccaagggcatcgagaccaccaccggcccgctcggc
cagggcatttccaccgcggtcggcatggcgctggccgaaaagatgctgcaggcggagtac
ggcaagaagatcgtcgaccatcacacctatgtgctggcctccgacggcgacctgatggag
ggcatctcccaggaagcgatcgcgatggccgggcactggaagctcaacaagctgatcgtg
ctgtgggatgacaacggcatctcgatcgacggcccgctgtcgatcgccgattcggtcgac
caggtgaagcgcttcaaggcgtgcggctgggccgccgagctgatcgacggccatgatccc
gaggcgatcgccgcggcgatcgcgcgggcgcagaagtcgagccggccgtcgctgatcgcc
tgcaagaccacgatcggctacggcgcgccgaccaaggctggcacctccaaggtgcatggc
gaggcgctcggcgcggaggagctgaagggcgcgaaggagaagctcggcatttcccaggag
ccgttctcggtgcccgatgacgtgctcgcggcctggcgcgaggccggccgccgcggcgcg
ccggcgcgcgccgaatgggagacccggctcggcgagatgggcccgcgcaagcgcgcggag
ttcgagcgccggctgcgccacgagcggcccgcggcgctggcaaaggcgctgaaggaccac
aagaaggcgctgctggagaacccgctgaacatcgccacgcgcaaatcgtcggaagccgcg
atcgaggtgattgcagctgcgatgcctttcgagttcgtcgctggctcggccgatctcacc
ggctccaacaacaacaaggcgaagtcggccacctcgttctcggccaagacgccgaagggc
cgcttcatccattacggcatccgcgagcacggcatggccgctgccatgaacggcatcttc
ctgcatggcggcttcgcgccgaacggcgccacattcctggtgttctcggactacgcgcgc
ggcgcaatgcggctgtcggcgctgatgggcgccggcgtggtctatgtgatgacccacgat
tcgatcggcctcggcgaggacggcccgacgcaccagccggtcgagcatctcgccgcactt
cgcgcgatcccgaacatgcgcgtgttccgcccggccgacgcggtcgagaccgccgaatgc
tgggagctggcgctcaaccgcaccaacggcccgaccgtgctggcgctgacgcggcagaac
ctcccgcagctgcgcacctcagcaccggcggacaatccctgcagccatggcggctacgag
ctggtagcggcgcagggcgacgccaaggtctcgctgttcgccaccggctcggaggtcgag
atcgcggtcgccgcgcagaagcagcttgccgagcgcggcatccccgcgcgcgtcgtctcg
gtcccctcgctggagctgctgctggagcagccagccgaggccaaggccaagatcatcggc
cacgcgccggtcaagatcgccatcgaggccgcggtgcgctggggctgggacgcggtgatc
ggcaccgacggcatcttcatcggcatgcattcgttcggcgagagcggcccctacaaggag
ctgtacaagcatttcggcatcaccgcggaagcggcggtggaagcggcggtgaagcggctg
gggtga

DBGET integrated database retrieval system