KEGG   Bradyrhizobium sp. ORS 278: BRADO1659Help
Entry
BRADO1659         CDS       T00516                                 

Gene name
cbbL
Definition
(GenBank) Ribulose bisphosphate carboxylase large chain (RuBisCO large subunit)
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00630  Glyoxylate and dicarboxylate metabolism
bra00710  Carbon fixation in photosynthetic organisms
bra01100  Metabolic pathways
bra01120  Microbial metabolism in diverse environments
bra01200  Carbon metabolism
Module
bra_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bra_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
bra_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:bra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BRADO1659 (cbbL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BRADO1659 (cbbL)
Enzymes [BR:bra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BRADO1659 (cbbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: CAL75537
RhizoBase: BRADO1659
UniProt: A4YNR1
LinkDB All DBs
Position
1777615..1779075
Genome map
AA seq 486 aa AA seqDB search
MNDQSITVRGKDRYKSGVMEYKKMGYWEPSYQPNDTDVIALFRVTPQDGVDPVEACAAVA
GESSTATWTVVWTDRLTAAEKYRAKCYRVEPVPGSPGSYFAYIAYDLDLFEPGSIANLTA
SIIGNVFGFKPLKALRLEDMRLPVAYVKTFQGPATGIVVERERLDKFGRPLLGATVKPKL
GLSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRERFLYCMEAVNKAQAATGEIKGT
YLNVTAATMEDMYERAEFAKELGSNIIMIDLVIGYTAIQSMAKWSRKNDMILHLHRAGHS
TYTRQRAHGVSFRVIAKWMRLAGVDHIHAGTVVGKLEGDPNTTRGYYDICREDFNPMRLE
HGVFFDQHWASLNKLMPVASGGIHAGQMHQLLDLLGEDVVLQFGGGTIGHPRGIAAGATA
NRVALEAMILARNEGRDYVHEGPEILAKAAMTCTPLREALEIWKDVTFNYESTDSPDFVP
TVTPAA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaccaatcgatcaccgtccgcggcaaggatcgctacaagtccggcgtgatggaa
tacaagaagatgggctattgggaaccgtcctatcagcccaatgacaccgacgtgatcgcg
ctgttccgcgtcactccgcaggacggagtcgacccggtcgaggcctgtgccgcggttgcc
ggtgaatcctcgaccgcgacctggaccgtggtgtggaccgaccgactgaccgccgccgag
aagtatcgcgccaagtgctaccgcgtcgagccggtgccgggctcgccgggcagctacttc
gcctatatcgcctacgatctcgatctgttcgagcccggttcgatcgccaacctcacggcc
tcgatcatcggcaacgtgttcggtttcaagccgctgaaagcgctgcggctggaggacatg
cggctgccggtggcctatgtgaagaccttccagggcccggcgaccggcatcgtcgtcgag
cgcgagcggctcgacaagttcggccgtccgctgctcggcgccaccgtcaagccgaagctc
ggtctctcgggacgcaactacggccgcgtcgtctatgaggcgctgaagggcggtctcgac
ttcaccaaggatgacgagaacatcaactcgcagcccttcatgcattggcgcgagcgcttc
ctgtactgtatggaagcggtcaacaaggcgcaggcggcgaccggcgagatcaagggcacc
tatctcaacgtcaccgcagcgacgatggaggacatgtatgagcgcgccgagttcgccaag
gagctcggctcgaacatcatcatgatcgacctcgttatcggctacaccgcgatccagtcg
atggcgaaatggtcccgcaagaacgacatgatcctgcatctgcatcgcgcgggacattcg
acctacacgcggcagcgcgcgcacggtgtctcgttccgcgtcatcgccaaatggatgcgg
ctcgccggcgtcgaccacatccatgccggcaccgtggtcggcaaactcgaaggcgatccg
aacaccacgcgcggctattacgacatctgccgcgaggacttcaacccgatgcggctcgag
cacggcgtgttcttcgaccagcactgggcgagcctcaacaagctgatgccggtggcctcg
ggcggcatccatgccggccagatgcaccagctgctcgacctgctcggcgaggacgtcgtg
ctgcagttcggcggcggcaccatcggccatccccgcggcatcgccgccggcgcgaccgcc
aaccgcgtcgcgctggaagcgatgatcctcgcccgcaacgagggccgcgactacgtccac
gagggtccggagattctcgccaaggcggcgatgacctgcacgccgctgcgcgaggcgcta
gagatctggaaggacgtcaccttcaactacgaatcgacggactctccggacttcgtcccg
accgtcacccccgcggcctaa

DBGET integrated database retrieval system