KEGG   Bradyrhizobium sp. ORS 278: BRADO1804Help
Entry
BRADO1804         CDS       T00516                                 

Gene name
idnD
Definition
(GenBank) L-idonate 5-dehydrogenase, NAD-binding
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
bra  Bradyrhizobium sp. ORS 278
Brite
KEGG Orthology (KO) [BR:bra00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BRADO1804 (idnD)
Enzymes [BR:bra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     BRADO1804 (idnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Methyltransf_25 Methyltransf_11 Methyltransf_31 ADH_N_assoc MTS
Motif
Other DBs
NCBI-ProteinID: CAL75676
RhizoBase: BRADO1804
UniProt: A4YP50
LinkDB All DBs
Position
1928564..1929595
Genome map
AA seq 343 aa AA seqDB search
MRAVVIHAPKDLRIDSFPDPAPEAGQVRVKIEAGGICGSDLHYYHHGGFGTVRIKQPMAL
GHEIAGVVAAVGAGVTGLAEGTRVAVNPSLPCGHCAYCREGLRNQCLDMRFMGSAMRDPH
VQGGFREFVTVDASQAVPIAPSLSLGEAAMAEPLSVCLHAAHQAGSLLGKRVLVTGCGPI
GALSILVARYGGAAEIVATDVAEAPLAVARKLGASHAVNVAAEPSALDPWRVGKGTFDVL
FEASGNQAALRAALDVMRPGGVIVQLGLGGEMTLPLNTLVTKELQLRGTFRFDREFDLAV
RLMGEGLLDVKPLISATLPFQEAISAFELASDRSRAMKVHLTF
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccgtcgtgattcacgcgcccaaggatctgcgcatcgacagcttccccgacccg
gcgccggaggcgggccaggtccgggtcaagatcgaggccggcggcatctgcgggtcggac
ctgcattattaccatcatggcggcttcggcacggtgcgcatcaagcagccgatggcgctc
ggccatgaaatcgcgggcgtcgtcgccgcggtcggcgccggcgtgaccggcctcgccgag
ggcacgcgtgtcgccgtcaatccaagcctgccgtgcggccactgcgcctattgccgcgag
ggcctgcgcaaccagtgcctggacatgcgcttcatgggcagcgcgatgcgcgacccgcac
gtgcagggcggctttcgcgagttcgtcaccgtcgatgcctcgcaggcggtgccgatcgcg
ccgtcactgtcgctgggtgaggccgcgatggccgagccgctgtcggtgtgcttgcatgcc
gcgcatcaggccggctcgctgctcggcaagcgcgtgctggtgaccggctgcggcccgatc
ggcgcgctgtcgatcctggtcgcgcgctatggcggcgcggccgaaatcgtggccaccgac
gtcgccgaggcgccgcttgccgtggcgcgcaagctcggcgccagccacgctgtcaacgtc
gccgcggagccatccgcgctcgatccctggcgcgtggggaagggcaccttcgacgtgctg
ttcgaggcgtccggcaaccaggccgcgctgcgcgcagcgctcgacgtgatgaggccgggc
ggggtcatcgtccagctcgggctcggcggcgaaatgacattgccgctcaacacgctggtc
acgaaggagctgcaattgcgcggcaccttccggttcgaccgcgaattcgatctggcggtg
cggctgatgggcgaggggctgctcgacgtgaagccgctgatctcagccacgctgccgttc
caggaggcaatttccgccttcgagctcgccagcgatcgaagccgcgcgatgaaggttcat
ttgacgttttaa

DBGET integrated database retrieval system