KEGG   Bradyrhizobium sp. ORS 278: BRADO1908Help
Entry
BRADO1908         CDS       T00516                                 

Gene name
glpD
Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase FAD/NAD(P)-binding (aerobic)
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00564  Glycerophospholipid metabolism
bra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bra00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BRADO1908 (glpD)
Enzymes [BR:bra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BRADO1908 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 FAD_binding_3 Pyr_redox FAD_oxidored NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: CAL75775
RhizoBase: BRADO1908
UniProt: A4YPE9
LinkDB All DBs
Position
2032290..2033834
Genome map
AA seq 514 aa AA seqDB search
MERIYDLAIVGGGVNGCGIARDAAGRGNSVFLCEMNDLASGTSSWSTKLVHGGLRYLEYY
EFRLVREALIEREILWQIAPHIIRPLRFVLPHHSGLRPAWLLRLGLFLYDHLGGRKLLPP
TRSVNLRSDEVGRPLIAGRYSSGFEYSDCFVDDARLVVLTARDAADRGAVIRTRTRATEI
RQDGSVWLVTTENIQNGERETIKARALVNAAGPWVEQVLSTGAGVNAKAKVRLVQGSHIV
VRKLYDHDRAYIFQNADGRIIFAIPYQQDFTLIGTTDRDYQGDPAKVKATDEEIAYLCAA
LGEYIAKPVTPADVVWSYSGVRPLYDDGASEAKAATRDYVFELDTPGGLPLLSIYGGKIT
TYRRLSEEALERLAPYLKGTQAEEGWTGKSSLPGGDMNVQAIDALITDLRRTCPFLSDAH
AKRIAHAYGTRAKAMLAGATSSADLGQDFGGTLTEREVRYLMTNEWALTAEDIVWRRSKL
GLRMSAAEIAALDAWITANRERSTVMAREAGGRA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
gtggagcggatctacgatctcgccattgtcggaggcggcgtgaacggctgcggcatcgcg
cgcgatgcggccggacgcggaaattccgtttttctctgcgaaatgaacgatcttgcgagc
ggaacctcgtcatggtcgacgaagctcgttcacggcggcctgcgctatctcgaatattac
gagttccggctggttcgcgaggcgctgatcgagcgcgagatcctgtggcagatcgcgccc
cacatcatccgtcccttgcgcttcgtcttgccgcatcattccggattgcggccggcttgg
ctgctccgcttgggcctgttcctgtatgaccatctcggcggccgcaagctgctgccgccg
acacgctcggtcaatctgcgcagcgacgaggtcggccggcccctgatcgccgggcgctac
agcagcggattcgaatattccgattgcttcgtcgatgatgcgcgcctcgtggtgctgacc
gcgcgcgatgccgccgaccgcggcgcagtgatccgcacgcgcacccgcgccaccgagatc
cgccaggacggcagcgtctggctggtcacgacggagaatatccagaacggcgagcgcgag
accatcaaggcgcgcgcgctggtcaatgccgccggtccctgggtcgagcaggtgctgtcg
accggcgccggcgtcaatgcgaaggcgaaggtgcggctggtgcagggctcgcacatcgtg
gtgcgcaagctctacgaccacgaccgcgcctacatcttccagaacgccgatggccgcatc
atctttgcgatcccctatcagcaggatttcacgctgatcggcaccaccgatcgcgactac
cagggcgatccggccaaggtgaaggcgaccgacgaggagatcgcctatctctgcgccgcg
ctcggcgaatatatcgccaagccggtcacgccggccgacgtggtgtggagctattccggc
gtgcggccgctctatgacgacggcgccagcgaggccaaggcggctacgcgcgattacgtg
ttcgagctcgatacgcccggcggcctgccgctgctgtcgatctatggcggcaagatcacc
acctatcggcggctgtcggaggaggccttggagcgcctcgcgccctatctgaaagggacg
caggcggaggagggctggaccggcaaatcgtcgctgcccggcggcgacatgaatgtgcag
gcgatcgacgctctcatcactgatctccgcaggacctgtccgtttctatcagatgcacat
gcgaagcgcatcgcacatgcctatggcacgcgggcgaaggccatgctcgcgggtgcgaca
tcttcggccgatctcggccaggattttggtggcaccttgacggagcgcgaagtcaggtac
ctgatgacgaacgagtgggcgttgacggccgaggacattgtgtggcggcgatcgaagctg
gggttgcggatgtcggcggctgagatcgccgcgctcgatgcgtggatcacggccaaccgc
gagcgctccaccgtgatggcgcgcgaagcgggaggacgcgcatga

DBGET integrated database retrieval system