KEGG   Bradyrhizobium sp. ORS 278: BRADO2275Help
Entry
BRADO2275         CDS       T00516                                 

Gene name
cbbS
Definition
(GenBank) Ribulose bisphosphate carboxylase small chain (RuBisCO small subunit)
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00630  Glyoxylate and dicarboxylate metabolism
bra00710  Carbon fixation in photosynthetic organisms
bra01100  Metabolic pathways
bra01120  Microbial metabolism in diverse environments
bra01200  Carbon metabolism
Module
bra_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bra_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
bra_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BRADO2275 (cbbS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BRADO2275 (cbbS)
Enzymes [BR:bra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BRADO2275 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small MukF_M
Motif
Other DBs
NCBI-ProteinID: CAL76110
RhizoBase: BRADO2275
UniProt: A4YQD4
LinkDB All DBs
Position
2424857..2425198
Genome map
AA seq 113 aa AA seqDB search
MSEAVAYKSAERRGETFSYLPPMTQDRLRRNIAYLIAQNWNPAIEHTEPEKSMSSFWYLW
KLPMFGERSIERILGELEACHRTNPGHHVRLIGYDNYSQSQGTAFIVYRAGGR
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagccgtcgcctacaaatccgccgaacgccgcggcgaaacgttttcgtatctg
ccgccgatgacgcaagaccggctgcgccggaacattgcctatctgatcgcgcagaactgg
aaccctgcgatcgagcacaccgagccggaaaagtcgatgtcgagcttctggtatctctgg
aagctgccgatgttcggtgagcgctcgatcgagcgcatcctgggtgagctcgaagcgtgt
catcgcaccaatcccggccatcacgtgcggctgatcggttacgacaactactcgcagtca
cagggcacggcgttcatcgtctatcgcgccggcggacgctag

DBGET integrated database retrieval system