KEGG   Bradyrhizobium sp. ORS 278: BRADO2580Help
Entry
BRADO2580         CDS       T00516                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00620  Pyruvate metabolism
bra00680  Methane metabolism
bra00710  Carbon fixation in photosynthetic organisms
bra01100  Metabolic pathways
bra01120  Microbial metabolism in diverse environments
bra01200  Carbon metabolism
Module
bra_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BRADO2580 (ppc)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BRADO2580 (ppc)
   00680 Methane metabolism
    BRADO2580 (ppc)
Enzymes [BR:bra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BRADO2580 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CAL76400
RhizoBase: BRADO2580
UniProt: A4YR74
LinkDB All DBs
Position
2762716..2765517
Genome map
AA seq 933 aa AA seqDB search
MLESVSMSPQAITEEIRPNRAADVQAMEADAQLREDIRLLGRILGDTVRDQEGADVFDLV
ERIRQTSVRFHRDEDRQARRELEQILDGMTIAETVRIVRAFSYFSHLANIAEDQNNIRRM
RAKSDANGGAGMLAATLAHAKSAGFDAAELRKFFSTALVSPVLTAHPTEVRRKSTMDREM
EVAMLLDRRERMQLTPEEREANDEALRRAVLTLWQTNLLRRTKLTVLDEVTNGLSFYDYT
FLREVPRLLCSLEDRLNDGAEVAGDLASFLRMGSWIGGDRDGNPFVTAEVMRGTLKLQSS
LAMHYYLEELHLLGSELSIAAHLADVSEELRALAEKSPDTSPHRRGEPYRLAVSGIYARL
AATAKKLGIEISRLPVADVAPYDSVKELQDDLDVLHHSLIANNAEVIARGRLRLLRRAVD
CFGFHLARLDIRQNSAVHERTVAELIDTAMPGMSYLALSEDARVGLLVNELRNTRPLVSH
FVKYSDETIGELELFRAAAEAHATFGADVISQCIISMCKGMSDMLEVALLLKEVGLIDPS
GRCAVNIVPLFETIEDLQASSGIMDRMLALHDYRRLVDSRGAVQEVMLGYSDSNKDGGFV
TSGWELYKAEIHLVEIFERHHVRLRLFHGRGGSVGRGGGPSYDAIIAQPGGAVNGQIRIT
EQGEIISSKYSNAEVGRYNLEILAAATLEASLLHPRQPAPKREYLTAMDRLSELAFKAYR
GLVYETDGFVDYFWSSTVINEIATLNIGSRPASRKKTRAIEDLRAIPWVFSWAQCRLMLP
GWYGFGSAVEAWIAENPEQGMPFLRELYQEWPFFRMLLSNMDMVLAKSSIAIASRYAELV
PDEALREQIFGRIRREWNLVIETLLDITGQERLLQGNPLLERSVRNRFPYLDPLNHVQVE
LLKEHRAQNPDEQVLRGIQLTINGISAGLRNTG
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atgctggagagcgtatccatgtcgccgcaagccatcacagaggaaatccgtcccaaccgc
gccgccgacgtgcaggccatggaagcggacgcgcagctccgcgaggatatccggctgctc
ggccgcatcctcggcgacaccgttcgcgaccaggagggcgccgacgtgttcgatctggtc
gagcgcatccgccagacctcggtgcgcttccaccgcgatgaggaccgtcaggcgcggcgc
gagctcgagcagatcctcgacggcatgaccattgcggagactgtccgcatcgtccgcgcc
ttcagctatttctcccacctcgccaacatcgccgaggaccagaacaacatccgccgcatg
cgcgccaagagcgatgccaatggcggcgccggcatgctggcggccacgctcgcccatgcc
aaatcggcgggattcgacgcggccgagttgcgcaagttcttctcgaccgcattggtcagc
cccgtccttaccgcgcacccgaccgaggtgcggcgcaagagtacgatggaccgcgagatg
gaggtcgcgatgctgctcgaccgccgcgagcggatgcagctgacgccggaggagcgcgag
gccaatgacgaggcgctgcgccgcgcggtgctgaccctgtggcagaccaacctcttgcgc
cggaccaagctgacggttctcgacgaggtcaccaatgggctgtcgttctacgactacacc
ttcctgcgcgaggtgccgcggctgttgtgctcgctcgaggaccggctcaacgacggcgct
gaggtggcgggcgacctcgcgtcgttcctgcgcatgggcagctggatcggcggcgaccgc
gacggcaatccgttcgtcaccgccgaggtcatgcgcggcacgctgaagctgcaatccagc
ctggcgatgcactactacctcgaagagctgcacctgctcggcagcgagctgtcgattgcc
gcgcatctcgccgatgtttcggaggagctgcgcgcgctcgcggagaagtctcccgacacc
tcgccgcaccggcgcggcgagccttaccggctggcggtgtccggcatctatgcccggctg
gccgcgaccgccaagaagctcggcatcgagatcagccgtctgccggtggctgatgtcgcg
ccctatgacagcgtcaaggagctgcaagacgatctcgacgtgctgcaccattcgctgatc
gcgaacaatgccgaggtgatcgcgcgcggacggttgcggctgctgcggcgcgcggtggac
tgcttcggcttccatctggcgcggctcgacatccgccagaactcggctgtgcacgagcgc
acggtggcggagctgatcgataccgccatgcccggcatgtcctacttggcgctaagcgag
gatgcacgggtcggcttgcttgtcaacgagctgcgcaatacgcgcccgctggtgtcgcat
ttcgtcaagtacagcgacgagaccatcggcgagctcgagctgttccgtgccgccgccgag
gcgcatgccacgtttggcgccgacgtgatctcccagtgcatcatctcgatgtgcaagggc
atgtccgacatgctggaggtcgcgctgctcttgaaggaggtcgggctgatcgacccgtcg
gggcgctgcgctgtcaacatcgtgccgctgttcgaaaccatcgaggatctgcaggcgtcc
agcggcatcatggaccggatgctggcgctgcacgactatcgccgcctggtcgacagccgc
ggcgccgtgcaggaggtcatgctcggctattccgacagcaacaaggatggcggcttcgtc
acctccggctgggagctgtacaaggccgagatccatctcgtcgaaatcttcgagcgccat
cacgtcaggctgcggctgttccacggccgtggcggctcggtcggccgcggcggcggaccg
agctacgacgccatcatcgcgcagcccggcggcgccgtgaacggccagatccgcatcacc
gagcagggcgagatcatctccagcaaatattccaacgcggaagtcgggcgctataatctg
gagatcctggcagcggcgacgctcgaagccagcctgctgcatccacgccagccggcgccg
aaacgcgaatatctcaccgcgatggatcgtctgtcggagcttgcattcaaggcctatcgt
ggccttgtctacgagaccgatggcttcgtcgattatttctggtcctcgaccgtcatcaac
gagatcgcgaccctgaacatcggcagccgtccggcgtcgcgcaagaagacccgcgcgatc
gaggatctgcgcgcgatcccctgggtgttctcctgggcgcagtgccggctgatgctgccg
ggctggtacggcttcggcagcgcggtcgaggcctggatcgcagagaatccggagcagggc
atgccgttcctacgcgagctctatcaggagtggccgttcttccgcatgctgctgtcgaac
atggacatggtgctcgccaagagctcgatcgccatcgcctcgcgctatgctgagctggtg
ccggacgaagccttgcgcgaacagatcttcggccgcatccgccgcgaatggaacctggtg
atcgagaccttgctcgacatcaccggccaggaacggctcctgcagggcaatccgctgctc
gagcgctcggtgcgcaaccgcttcccatatctcgacccgctcaatcacgtgcaggtcgag
ctgttgaaagagcaccgcgcgcagaacccggacgagcaggtgctgcgcgggattcagctg
accatcaacggcatctcggcgggcttgaggaatacggggtag

DBGET integrated database retrieval system