KEGG   Bradyrhizobium sp. ORS 278: BRADO3064Help
Entry
BRADO3064         CDS       T00516                                 

Gene name
tufB
Definition
(GenBank) Elongation factor Tu (EF-Tu)
  KO
K02358  elongation factor Tu
Organism
bra  Bradyrhizobium sp. ORS 278
Brite
KEGG Orthology (KO) [BR:bra00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bra03012]
    BRADO3064 (tufB)
   03029 Mitochondrial biogenesis [BR:bra03029]
    BRADO3064 (tufB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bra04147]
    BRADO3064 (tufB)
Translation factors [BR:bra03012]
 Eukaryotic Type
  Elongation factors
   BRADO3064 (tufB)
 Prokaryotic Type
   BRADO3064 (tufB)
Mitochondrial biogenesis [BR:bra03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BRADO3064 (tufB)
Exosome [BR:bra04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BRADO3064 (tufB)
  Exosomal proteins of breast cancer cells
   BRADO3064 (tufB)
  Exosomal proteins of colorectal cancer cells
   BRADO3064 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CAL76866
RhizoBase: BRADO3064
UniProt: A4YSJ0
LinkDB All DBs
Position
3271707..3272897
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKILAETGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETQNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKCDMVDDPELLELVELEVRELLSKYEFPGDKIPIIKGSALAALE
DSDKKLGHDAILELMRNVDEYIPQPERPIDQPFLMPVEDVFSISGRGTVVTGRVERGVIK
VGEEIEIVGIRPTQKTTVTGVEMFRKLLDQGQAGDNIGALLRGTKREDVERGQVLCKPGS
VKPHTKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNIA
MEVHLIVPIAMEEKLRFAIREGGRTVGAGVVASIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagctaagtttgaacgtaacaagccccactgcaacatcggcaccatcggtcac
gtcgaccatggcaagacgtcgctgacggctgccatcaccaagatcctggccgagacgggc
ggtgcgacgttcactgcctacgaccagatcgacaaggcgcccgaagagaaggcccgcggc
atcaccatctcgaccgcccacgtcgagtacgagacgcagaaccgccactacgcgcacgtc
gactgccccggccacgccgactacgtgaagaacatgatcaccggcgccgcccagatggac
ggcgcgatcctggtcgtgtcggctgccgacggcccgatgccgcagacccgcgagcacatc
ctgctcgcccgccaggtcggtgttcccgcgctggtcgtgttcctgaacaagtgcgacatg
gtcgacgatccggagctgctcgagctggtcgagctcgaggttcgcgagctgctctcgaag
tatgaattcccgggcgacaagatcccgatcatcaagggctcggcgctcgccgctctcgaa
gattcggacaagaagctcggccacgacgccatcctcgagctgatgcgcaatgtcgacgag
tacattccgcagccggagcgtccgatcgaccagcccttcctgatgccggtcgaagacgtg
ttctcgatctcgggccgcggcaccgtggtgaccggtcgtgtcgagcgcggcgtgatcaag
gtcggtgaggaaatcgagatcgtcggcatccgtccgacccagaagaccaccgtcaccggc
gtcgaaatgttccgcaagctgctcgatcagggccaggctggcgacaacatcggtgcgctg
ctccgcggcaccaagcgtgaggacgtcgagcgcggccaggttctctgcaagccgggttcg
gtcaagccgcacaccaagttcaaggccgaggcgtacatcctcaccaaggaagagggcggc
cgtcacactccgttcttcaccaactatcgtccgcagttctacttccgcacgaccgacgtg
accggcgtcgttcacctgccggaagggaccgagatggtgatgccgggcgacaacatcgcg
atggaagtgcacctgatcgtgccgatcgcgatggaagagaagctgcgcttcgccatccgt
gaaggcggccgcaccgtcggcgccggcgtcgtcgcctcgatcatcgagtaa

DBGET integrated database retrieval system