KEGG   Bradyrhizobium sp. ORS 278: BRADO3719Help
Entry
BRADO3719         CDS       T00516                                 

Definition
(GenBank) putative glutathione S-transferase enzyme with thioredoxin-like domain
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
bra  Bradyrhizobium sp. ORS 278
Brite
Enzymes [BR:bra01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     BRADO3719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: CAL77491
RhizoBase: BRADO3719
UniProt: A4YUB5
LinkDB All DBs
Position
3881736..3882476
Genome map
AA seq 246 aa AA seqDB search
MMSPRNRRATAPMSDLSSFPITQRWPAQHPDRIQLYSLPTPNGVKVSIMLEETGLPYEPH
TIDFGKDDQKTPEFLSLNPNGKIPAIIDPDGPGGQPLGLFESGAILQYLAEKTGKFLPAD
PARRWQTIQWVHFQMGGIGPMFGQLGFFHKFAGREYEDKRPLQRYVAESKRLLSVLEARL
GGREWIMDLDYTIADIASLGWVRNLIGFYGARELVAFDELKHVPAWLERGLARPAVQRGL
EIPKRP
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
ttgatgtctccacgcaacaggcgagcaacagcccccatgtccgatctctccagcttcccg
atcacccagcgctggccggcgcagcatccggatcgcatccagctctattcgctgccgacg
cctaacggcgtgaaggtctcgatcatgctggaggagacgggcctgccttacgagccgcac
acgatcgatttcggcaaggacgaccagaagaccccggaattcctgtcgctcaatccgaat
ggcaagatccccgcgatcatcgatccggacggacccggcggccagccgctcggcctgttc
gaatccggcgcgatcctgcaataccttgccgagaagaccggcaaattcttgcccgccgat
ccggcgcggcgctggcagaccatccaatgggtgcatttccagatgggcggcatcgggccg
atgttcggccagctcgggttctttcacaagttcgcgggccgtgaatatgaagacaagcgg
ccgttgcagcgttacgtcgccgagagcaagcggctgctgagcgtgctcgaggcgcggctc
ggcggacgcgagtggatcatggatctcgactacacgatcgccgacatcgccagcctcggc
tgggtgcgcaacctgatcggcttttacggcgcgcgcgagctggtggcgttcgatgagctc
aagcatgtgccggcctggctggagcgcggcctggcgcggccggcggtgcagcgcgggctg
gagatcccgaagcggccgtga

DBGET integrated database retrieval system