KEGG   Bradyrhizobium sp. ORS 278: BRADO5656Help
Entry
BRADO5656         CDS       T00516                                 

Gene name
ddlB
Definition
(GenBank) D-alanine-D-alanine ligase, affects cell division
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00473  D-Alanine metabolism
bra00550  Peptidoglycan biosynthesis
bra01100  Metabolic pathways
bra01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bra00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BRADO5656 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BRADO5656 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BRADO5656 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bra01011]
    BRADO5656 (ddlB)
Enzymes [BR:bra01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BRADO5656 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:bra01011]
 Precursor biosynthesis
  Amino acid ligase
   BRADO5656 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 CN_hydrolase ATPgrasp_ST ThiC_Rad_SAM
Motif
Other DBs
NCBI-ProteinID: CAL79326
RhizoBase: BRADO5656
UniProt: A4YZK0
LinkDB All DBs
Position
complement(5848920..5849909)
Genome map
AA seq 329 aa AA seqDB search
MRTTILFGGSNKERLVSVASAKALHAALPEADLWFWEADDTVQQASGPALVAHAKPFEEP
FTADGVRIGTLAEALDRARAEDRILVLGLHGGRAENGELQVMCEMRGVPFTGSSSAASHL
AFDKVAAKRFAVLGGVTAAEGVALDNAETALARYGKLIAKPVKDGSSFGLIFVNAKQDLV
AVKAAAATEEYLIEPFVTGKEATCGVLEQADGSLIALPPIEILPADGAFNYFAKYLAAAT
KEICPGRFNPEVTAALQREAIKAHRALSCGGYSRTDFIVSADGPVYLETNTLPGLTAASL
YPKALAAQGIPFADFLQQQIALAERRVRH
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaccacgattctgttcggcggctccaacaaggaacgtctcgtctcggtcgccagc
gccaaggcgctgcacgccgcgctgccggaggcggacctctggttctgggaggccgacgac
actgtgcagcaggcaagcggcccagcgctggtcgcccacgcaaagccgttcgaggagccg
ttcacggccgacggcgtccggatcggcacgctcgccgaggcgctcgatcgtgcccgcgcc
gaggaccggatcctggttctcggacttcatggcggacgggcggagaacggcgagcttcaa
gtgatgtgcgagatgcggggcgtgccgttcaccggctcgagctcggcggcctcgcacctc
gccttcgacaaggtcgccgccaagcgcttcgccgtactcggtggcgtcacggcggccgaa
ggtgtcgcgctcgacaatgccgagacagctctcgcgcgttacggcaagctgatcgccaag
ccggtgaaggatggctcgagcttcggcctgatcttcgtcaacgccaaacaggacctcgtc
gccgttaaggccgccgctgcgaccgaggagtatctcatcgagccgttcgtcaccgggaag
gaggcgacctgcggcgtgctcgagcaggcggacggctcgttgatcgcgctgccgccgatc
gagatcctgccggccgacggcgccttcaactacttcgcgaagtacctggcggccgcgacg
aaggagatctgtccgggacgcttcaatccggaggttacggcagcgctgcagcgagaggcg
atcaaggcgcatcgtgcgctgtcctgcggcggctactcgcgcaccgacttcatcgtctcg
gccgacggcccggtctatctcgagaccaacacgctgcccggcttgaccgccgcctcgcta
tatccgaaggcgctcgcggcgcagggtatcccctttgccgactttctgcagcagcagatc
gccttggcggaacgccgcgttcggcactga

DBGET integrated database retrieval system