KEGG   Bradyrhizobium sp. ORS 278: BRADO5768Help
Entry
BRADO5768         CDS       T00516                                 

Definition
(GenBank) putative maleylacetoacetate isomerase (MAAI) (Glutathione S-transferase)
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bra00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BRADO5768
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bra02000]
    BRADO5768
Enzymes [BR:bra01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BRADO5768
Transporters [BR:bra02000]
 Other Transporters
  Pores ion channels [TC:1]
   BRADO5768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_C_2 GST_N_2 GST_C_3 GST_N
Motif
Other DBs
NCBI-ProteinID: CAL79435
RhizoBase: BRADO5768
UniProt: A4YZV9
LinkDB All DBs
Position
complement(5970065..5970721)
Genome map
AA seq 218 aa AA seqDB search
MTKATLTISSKNYSSWSLRGWLLAKFAGLDFDELVVGPDDASARAEILLLSSSILVPCLR
HDGATIWDTLAIGEYLNETFPHAGLLPSDRIARAHCRSISGEIHSGFTTLRASLPVNLKG
HFPGFKVWTRAQADIDRIWAIWRDCLDKSGGPFLFGQQRGMADAMYAPVVTRFVTYDVKL
EPRLKAYADLIMAMPEMQEWITAAKAEPEEIEELEVEY
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagcgacgttgacgatcagcagcaagaattactcgtcatggtcgctgcgcggc
tggctgctcgccaaatttgccgggctcgatttcgacgagctggtcgtcggcccggacgat
gcgtccgcgcgcgccgagatcctgctgttgtcatcgtcgatcctggtgccctgcctgcgg
cacgacggcgcgacgatctgggatacgctggcgatcggcgagtatctcaacgagaccttt
ccgcacgccggtctgctgccttctgatcgcatcgcgcgcgcgcattgccgctcgatctcc
ggtgaaatccactccggcttcaccaccttgcgcgcatcgctgccggtcaacctcaagggc
cattttcctggcttcaaggtgtggacccgcgcccaggccgacatcgaccgcatctgggcg
atctggcgtgactgcctcgacaaatcgggcgggccatttctgttcggacagcagcgcggc
atggcggatgcgatgtacgccccggtggtgacgcgcttcgtgacctatgacgtcaagctc
gagccccggctcaaggcctacgccgacctgatcatggcgatgcccgagatgcaggaatgg
atcacggcggccaaggccgagcccgaggagatcgaggagctcgaggtcgagtattag

DBGET integrated database retrieval system