KEGG   Bradyrhizobium sp. ORS 278: BRADO6583Help
Entry
BRADO6583         CDS       T00516                                 

Definition
(GenBank) putative D-alanyl-D-alanine carboxypeptidase
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
bra  Bradyrhizobium sp. ORS 278
Brite
Enzymes [BR:bra01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BRADO6583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 Peptidase_S13 DUF4858 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: CAL80189
RhizoBase: BRADO6583
UniProt: A4Z213
LinkDB All DBs
Position
6832354..6833784
Genome map
AA seq 476 aa AA seqDB search
MQTLRLLFRYSPLKIIAVAAALMLAPRMAHAEALLLVEADTGKVLEAQNATYPWYPASVT
KLMTAYVTLKAVKDGKASLDTLLTVSPTAASQSPSKMGYRPGTQVTVDNALKMMLVKSAN
DMAVVLAEGIGGSIDGFSIMMNETAQRLGMTQTSYVNPNGLPADGQITSARDLAILARAI
IRDLPEYEYFVHIPSIRYGRRVVQNFNRLIGRYPGADGFKTGFICASGYNLVASATRNGK
RLIAVVLGASSGQMRAVRAIQMLDRGFNTNQLSWLKAPLGNVEQLVPVDATPPNLRDDMC
SGRRHRPASDDDGEEASNEGETTTGGTLLAGLQAPALKPSEILAAAPAPSEPVLVYTGPT
RTGPALIAAVAADADAQTPPKHRGKKAHAAGKTDAKPATHTAAKSDGKTGSEAKPAGKPD
SKTADAKSATARHVAAKHDTGAKSADKPASDTAAKPAKPKAAARPKTDGKPAPKDG
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
gtgcagacgcttcgcctgttgttccgctattccccgctgaagatcatcgctgttgctgcc
gcgctaatgctcgcgccgcgtatggcccatgccgaggcgcttctgctcgtcgaggccgac
accggcaaggtgctcgaggcgcagaacgcgacctatccctggtaccccgcctccgtcacc
aagctgatgacggcctatgtcacgctgaaggcggtgaaggacggcaaggcctcgctcgac
acgctgctgacggtgtcgccgaccgcggcgtcgcaatcgccctcgaagatgggctaccgg
ccgggcacacaggtcaccgtcgacaacgcactgaagatgatgctggtgaagtcggccaac
gacatggctgtcgtgctggcggaaggcatcggcggctcgatcgacggcttctcgatcatg
atgaacgagaccgcgcagcggctcggcatgacccagacgagctacgtcaatccgaacggc
ctgcccgccgacggccagatcacctcggcccgcgacctcgcgatcctggcgcgcgccatc
attcgcgacctgccggaatacgaatatttcgtccacatcccctcgatccgctacggccgc
cgggtggtgcagaacttcaaccggctgatcgggcgctatcccggcgccgacggcttcaag
accggcttcatctgcgcctccggctacaatctggtggcgtccgccacccgcaacggcaag
cgcctgatcgcggtcgtgcttggcgcctcctcaggccagatgcgcgcggtgcgcgcgatc
cagatgctcgatcgcggcttcaacaccaatcaactcagctggctcaaggcgccgctcggc
aatgtcgagcagctggtgccggttgacgccaccccgccgaacctgcgcgatgacatgtgc
agcggccgccggcaccggcccgccagcgatgacgacggcgaggaggcgagcaacgagggc
gagacgaccaccggcgggacgctgctcgccgggctgcaggcgccggcgctgaagccgtcg
gagatcctggcagcagcgcctgcgccgtccgagcccgtgctggtctataccggcccgacc
cgtaccggtcctgcgctgatcgccgccgtcgcggctgacgccgatgcccagaccccgccc
aagcaccgcggcaagaaggcgcatgccgccgggaagaccgacgccaagccggcgacgcac
acggcggccaagtctgatggcaagaccggcagtgaggccaagccggccggcaagcctgat
tcgaagaccgccgacgccaagtcggccacggcacgccacgtcgccgccaagcacgacacg
ggcgcgaaatctgcggacaagccggcctccgacaccgcggccaagccggccaagcccaag
gcagccgccaggccgaagaccgacggcaagccggcgccgaaggacggctga

DBGET integrated database retrieval system