KEGG   Bradyrhizobium sp. ORS 278: BRADO7029
Entry
BRADO7029         CDS       T00516                                 

Gene name
rfbB
Definition
(GenBank) dTDP-D-glucose 4,6-dehydratase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00521  Streptomycin biosynthesis
bra00523  Polyketide sugar unit biosynthesis
bra00525  Acarbose and validamycin biosynthesis
bra01100  Metabolic pathways
bra01110  Biosynthesis of secondary metabolites
Module
bra_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:bra00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BRADO7029 (rfbB)
   01055 Biosynthesis of vancomycin group antibiotics
    BRADO7029 (rfbB)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BRADO7029 (rfbB)
   00525 Acarbose and validamycin biosynthesis
    BRADO7029 (rfbB)
Enzymes [BR:bra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     BRADO7029 (rfbB)
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 3Beta_HSD adh_short Sacchrp_dh_NADP KR NAD_binding_10
Other DBs
NCBI-ProteinID: CAL80615
RhizoBase: BRADO7029
UniProt: A4Z389
LinkDB
Position
7332449..7333522
AA seq 357 aa
MRFKGSTIFVTGGAGFIGSAVVRHLLRDTHARVVNIDKLTYAANLDSLPGAAGNPHYAFE
QADICDAAALRKLFDKYQPDAVMNLAAESHVDRSIDGPGEFIQTNIVGTFTLLQEALRHF
RSLSPEKRAGFRFLHISTDEVFGTLGDTGLFTETTAYAPNSPYSASKASSDHLVRAWRET
YELPTMITNCSNNYGPYHFPEKLIPHMIIKGLGFETLPVYGDGQNIRDWLFVEDHARALT
LVLERGQVGETYNVGGRNERTNLHVVETICDLLDAVAPGPQGGRRQLISFVTDRPGHDRR
YAIDASKLERELGWRAEETFETGIAKTVRWYVQEKPWWQAILQRGYQTERLGRKAAH
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgcgtttcaagggctcgaccatcttcgtcaccggcggcgccggcttcatcggctcggcc
gtggtgcggcacctcttgcgcgacacccatgcccgcgtggtcaacatcgacaagctgacc
tacgccgccaatctcgattcgctgcccggcgcggccggcaatccgcattacgccttcgag
caggccgatatctgcgacgcggccgccttgcgcaagctgttcgacaagtaccagcccgac
gcggtgatgaacctcgccgccgagagccatgtcgaccgctcgatcgacggccccggcgag
ttcatccagaccaacatcgtcggcaccttcacgctgctgcaggaggcgctgcgccacttc
cgcagcctgtctccggagaagcgcgccggcttccgcttcctgcacatctcgaccgacgag
gtgttcggcacgctcggcgacaccggcctgttcaccgagaccacggcctacgcgcccaac
tcgccctattcggcgagcaaggcctcgtccgaccatctggtgcgggcctggcgcgagacc
tacgagctgccgaccatgatcaccaactgctcgaacaattacgggccgtatcacttcccc
gagaagctgatcccgcacatgatcatcaagggcctcggcttcgagacgctgccggtctat
ggcgacggccagaacatccgcgactggctgttcgtcgaggaccacgcgagggcgttgacc
ctggtgctggagcgcggccaggtcggcgagacctacaatgtcggcggccgcaacgagcgc
accaatctgcacgtggtcgagaccatctgcgacctgctcgacgcggtcgcgccggggccg
caaggcggccgccgccagctgatcagcttcgtcaccgaccgccccggccacgaccgccgc
tacgccatcgacgcctccaagctggagcgcgagctcggctggcgcgccgaggagactttc
gagaccggcatcgccaagaccgtccgctggtatgtccaggagaaaccgtggtggcaggcg
atcctgcagcgcggctatcagaccgagcggctcggccgcaaggcagcgcattga

DBGET integrated database retrieval system