KEGG   Bradyrhizobium sp. BF49: BF49_0063Help
Entry
BF49_0063         CDS       T04337                                 

Definition
(GenBank) Glutathione Stransferase EC 25118
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
brad  Bradyrhizobium sp. BF49
Pathway
brad00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:brad00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BF49_0063
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:brad02000]
    BF49_0063
Enzymes [BR:brad01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BF49_0063
Transporters [BR:brad02000]
 Other Transporters
  Pores ion channels [TC:1]
   BF49_0063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: CUT08983
UniProt: A0A160U2Y4
LinkDB All DBs
Position
I:70940..71536
Genome map
AA seq 198 aa AA seqDB search
MIKLYWSPRSRSFTTLWLMEESGLPYERVLTDISTGAQKAPDFLKVNPMGKVPALTDGDA
ALGEAAAICVYIADRYPETGLAPTVADPRRARYLQWLFFSPGCIEPAIIQIFTKIELPTS
TAAWGSATQVFDVLEAVLAKGPWILGEEFSAADITIGSGLNFAVRLFKMVPSRPAFDAYL
ARCMARPAFQRAEKIAAG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagctctactggtcgcctcgctcgcgctcgttcacgacgctctggctgatggag
gaaagcggcctgccctatgagcgcgtgctgaccgacatttcgaccggcgcgcagaaagcg
ccggattttctcaaggtcaatccgatgggcaaggttccggcactgaccgacggcgatgcc
gcgctgggcgaggccgccgccatctgcgtctacattgccgatcgctatcccgagaccggg
ctggcgccaaccgtggccgatccgcgccgcgcgcgttacctgcaatggttgttcttctcg
ccgggctgcatcgaacccgccatcatccagatcttcaccaagatcgagcttccgacatcg
accgcggcctggggcagcgcgacgcaggtcttcgacgtgctggaagccgtgcttgcgaag
gggccgtggattctcggggaggaattttcggccgccgacatcacgatcggatcgggcctg
aacttcgcggtgcgcctgttcaagatggtgccgtcgcgcccggccttcgatgcctatctc
gcgcgctgcatggcgaggccggcgttccagcgcgcggagaagatcgcggccggttag

DBGET integrated database retrieval system