KEGG   Bradyrhizobium sp. BF49: BF49_0592Help
Entry
BF49_0592         CDS       T04337                                 

Definition
(GenBank) Shikimate kinase I EC 27171
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
brad  Bradyrhizobium sp. BF49
Pathway
brad00400  Phenylalanine, tyrosine and tryptophan biosynthesis
brad01100  Metabolic pathways
brad01110  Biosynthesis of secondary metabolites
brad01130  Biosynthesis of antibiotics
brad01230  Biosynthesis of amino acids
Module
brad_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:brad00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BF49_0592
Enzymes [BR:brad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     BF49_0592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 AAA_16 Mg_chelatase AAA_22 RsgA_GTPase CoaE MMR_HSR1 AAA_5
Motif
Other DBs
NCBI-ProteinID: CUT09512
UniProt: A0A160U2U7
LinkDB All DBs
Position
I:626316..626939
Genome map
AA seq 207 aa AA seqDB search
MPDAALPIQASPEADILSALGTRSIVLVGMMGVGKSTIGRRMALRLKLPFVDADTEIEAA
AGMTIPEIFERHGEPHFRDGEARVIARLLDGGPIVLATGGGAFMREETRGRIAAKAISIW
LKADHDVIMRRVRRRADRPLLQTADPEGTVTRLLTEREPVYGHADLTIASRDVPHDKIVE
ETIETLRAHLCGERASPPPADVASAAR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacgccgcgttgccgatccaagcctcgcccgaggccgacatcctgtcggcgctg
gggacgcgctcgatcgtgctcgtcggcatgatgggagtgggcaaatccaccatcggccgc
cgcatggcgctcaggctcaagctgcccttcgtcgatgccgataccgagatcgaggcagcg
gccggcatgaccataccggaaatcttcgagcgccacggcgagccgcatttccgcgacggc
gaggcccgcgtgatcgcgcgtctgctcgacggcggtcccatcgtgctggcgaccggcggc
ggcgctttcatgcgcgaggagacgcggggccgtatcgcggcgaaggcgatctcgatctgg
ctcaaggccgatcatgatgtcatcatgcgccgcgtgcgccggcgcgccgaccgtccgctg
ctccagaccgccgatcccgaaggaaccgtgacgcgcctgctcaccgagcgcgagccggtc
tacggccatgccgacctcaccattgcctcgcgcgacgtgccgcacgacaagatcgttgag
gagaccatcgagacgctgcgcgcgcatctttgcggcgaacgggcgtccccgccaccagcc
gacgtcgcgagtgccgcacgatga

DBGET integrated database retrieval system