KEGG   Bradyrhizobium sp. BF49: BF49_0695Help
Entry
BF49_0695         CDS       T04337                                 

Definition
(GenBank) Methyltransferase
Organism
brad  Bradyrhizobium sp. BF49
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_23 Methyltransf_11 Methyltransf_12 Methyltransf_31 TehB Methyltransf_PK CMAS Methyltransf_29 PCMT DUF938 MTS
Motif
Other DBs
NCBI-ProteinID: CUT09615
UniProt: A0A160U497
LinkDB All DBs
Position
I:complement(729155..729742)
Genome map
AA seq 195 aa AA seqDB search
MDEGTLQFYRSNARSYADWAKAPSTRLRGFLALLPSGGSILELGCGAGNHSAVMLAEGFS
VRATDGSPEMAEIASQRLGHAVEAMRFDQLDAHEAYDGVWASACLLHVPRDELAGILARI
HRALRPSGVFYASYKMGEGDGRDSLGRYYNYASPEWLEATYASAGPWITLSSDRNVIRSF
DETPANMLHLVVRKA
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
gtggacgaagggactctgcaattctatcggagcaacgcccggtcctatgcggactgggcg
aaggcgccctcgacgcggctgcgaggctttctcgctctgctgccgtccggcggctcgatc
ctcgagctcggctgtggcgccggcaatcattcggcggtgatgctggccgaaggtttttca
gtgcgcgccaccgacggctcgcctgaaatggccgagatcgcgtcgcagcggctcggtcat
gccgtcgaggcgatgcggttcgaccagcttgacgcgcacgaggcctatgacggcgtctgg
gccagcgcctgtctcctgcacgtaccgcgcgacgaactcgccggcatcctggcgcggatt
catcgcgcgctcaggccgtcaggcgtgttctatgccagctacaagatgggcgagggcgac
ggccgggacagcctcgggcgttactacaattatgcgtcgccagaatggctcgaggcgacc
tacgccagcgcgggtccatggatcacgctgtcgtcggacaggaacgtgatccggagcttt
gacgagacgccggcgaacatgctgcatctcgtcgttcgcaaggcctga

DBGET integrated database retrieval system